DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and sdz-12

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_494634.1 Gene:sdz-12 / 184388 WormBaseID:WBGene00017406 Length:330 Species:Caenorhabditis elegans


Alignment Length:227 Identity:64/227 - (28%)
Similarity:97/227 - (42%) Gaps:22/227 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 GGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTL 235
            |..|..:.| |.|:.|..:|:|..|::||::.|:|.|..:|..||:.|||:|.|..|...|.|..
 Worm    54 GRSNVVNHK-FRCENCEKQFTNKPNLKRHQITHSGSKSKKCSTCQRTFFREDQLQRHLHNHLKER 117

  Fly   236 P-YHCPI--CNRGFQRQIAMRAHFQNEHVGQHDLVKTCPLCSYRAGSMKSLRIHFFNRHGIDLDN 297
            . :.||:  |:..|.....:..|..|.|...:.....|..|....||.:.|.:|:...|...|.:
 Worm   118 SHFDCPVLNCSMQFVFYEGVENHLVNHHHFSYSESAPCGKCHKLFGSPRHLLVHYHFDHKEALRS 182

  Fly   298 PGPGGTSSLLLA----LESQASAAAAAAAASYVPP-------GLSPVPVQSQSQQQQ------QQ 345
            ..|..|||..|:    ..|.:..|..|.:....||       |.||: ::...:|..      .|
 Worm   183 SAPAPTSSARLSPITVSTSGSPRAQLAISPQEKPPQKLSINLGTSPM-IEEFCEQNSATLPNTDQ 246

  Fly   346 QVAPPASDSGESMRSLENATPPMHFLTPHVEI 377
            |::|..|.:....|:|..:.|...|...|..|
 Worm   247 QLSPTLSPNEPRFRNLITSEPTPSFECKHCTI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 7/19 (37%)
zf-H2C2_2 195..218 CDD:290200 9/22 (41%)
C2H2 Zn finger 211..231 CDD:275368 9/19 (47%)
C2H2 Zn finger 239..255 CDD:275368 4/17 (24%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
sdz-12NP_494634.1 SFP1 <25..86 CDD:227516 11/32 (34%)
C2H2 Zn finger 29..48 CDD:275368
COG5236 <32..>197 CDD:227561 45/143 (31%)
C2H2 Zn finger 65..85 CDD:275368 7/19 (37%)
C2H2 Zn finger 93..113 CDD:275368 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159859
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BKBX
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003075
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24404
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.800

Return to query results.
Submit another query.