DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG12769 and ZNF597

DIOPT Version :9

Sequence 1:	NP_001286181.1	Gene:	CG12769 / 35770	FlyBaseID:	FBgn0033252	Length:	713	Species:	Drosophila melanogaster
Sequence 2:	NP_689670.1	Gene:	ZNF597 / 146434	HGNCID:	26573	Length:	424	Species:	Homo sapiens

Alignment Length:	94	Identity:	35/94 - (37%)
Similarity:	47/94 - (50%)	Gaps:	1/94 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   176 SSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 240
            |..|..:|..|...|::.||:|.|:..|||.|||:|..|...|.:..||:.|..:|.|..||.|.
Human   179 SGEKKHKCGDCGKIFNHRANLRTHRRIHTGEKPYKCAKCSASFRQHSHLSRHMNSHVKEKPYTCS 243

  Fly   241 ICNRGFQRQIAMRAHFQNEHVGQHDLVKT 269
            ||.|||.....:..| |..|..::....|
Human   244 ICGRGFMWLPGLAQH-QKSHSAENTYEST 271

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG12769	NP_001286181.1	C2H2 Zn finger	183..203	CDD:275368	7/19 (37%)
		zf-H2C2_2	195..218	CDD:290200	11/22 (50%)
		C2H2 Zn finger	211..231	CDD:275368	6/19 (32%)
		C2H2 Zn finger	239..255	CDD:275368	6/15 (40%)
		C2H2 Zn finger	662..689	CDD:275371
		C2H2 Zn finger	690..712	CDD:275371
ZNF597	NP_689670.1	KRAB	13..54	CDD:307490
		COG5048	150..>422	CDD:227381	35/94 (37%)
		C2H2 Zn finger	158..178	CDD:275368
		C2H2 Zn finger	186..206	CDD:275368	7/19 (37%)
		C2H2 Zn finger	214..234	CDD:275368	6/19 (32%)
		C2H2 Zn finger	242..262	CDD:275368	8/20 (40%)
		C2H2 Zn finger	343..363	CDD:275368
		C2H2 Zn finger	371..391	CDD:275368
		C2H2 Zn finger	399..419	CDD:275368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165152368
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930