DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and ZNF786

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_689624.2 Gene:ZNF786 / 136051 HGNCID:21806 Length:782 Species:Homo sapiens


Alignment Length:212 Identity:52/212 - (24%)
Similarity:80/212 - (37%) Gaps:48/212 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HSPPMTFRCERCDSFETSSRASLLLHVVQCLAGQAAAAAAAAAASARLKSEDLQEPENMSLGHME 143
            ||....|.|..|....|  |.|.|...::..:|:..........|.|||.:        .|.|..
Human   559 HSKERPFSCGECGKGFT--RQSKLTEHLRVHSGERPFQCPECNRSFRLKGQ--------LLSHQR 613

  Fly   144 GGKGDGQTGNGSSSSASSSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMRRHKMRHTGVKP 208
            ...|:                              :.|:|..|:.::...|:|:.|::.|:|..|
Human   614 LHTGE------------------------------RPFQCPECDKRYRVKADMKAHQLLHSGEMP 648

  Fly   209 YECRVCQKRFFRKDHLAEHFTTHTKTLPYHCPICNRGFQRQIAMRAHFQNEHVGQHDLVKTCPLC 273
            :.|. |.|.|.:...|.||..|||...|:.||.|::.|:.:..:.:| |..|.|:...  .||.|
Human   649 FSCE-CGKGFVKHSKLIEHIRTHTGEKPFQCPKCDKSFRLKAQLLSH-QGLHTGERPF--HCPEC 709

  Fly   274 S----YRAGSMKSLRIH 286
            .    .|...::..|||
Human   710 DKNFRERGHMLRHQRIH 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
zf-H2C2_2 195..218 CDD:290200 8/22 (36%)
C2H2 Zn finger 211..231 CDD:275368 7/19 (37%)
C2H2 Zn finger 239..255 CDD:275368 4/15 (27%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
ZNF786NP_689624.2 KRAB 9..67 CDD:214630
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 141..164
C2H2 Zn finger 242..262 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 285..364
C2H2 Zn finger 371..391 CDD:275368
C2H2 Zn finger 399..419 CDD:275368
C2H2 Zn finger 427..447 CDD:275368
C2H2 Zn finger 455..475 CDD:275368
COG5048 <471..722 CDD:227381 49/206 (24%)
C2H2 Zn finger 483..503 CDD:275368
C2H2 Zn finger 511..531 CDD:275368
C2H2 Zn finger 539..559 CDD:275368 52/212 (25%)
C2H2 Zn finger 567..587 CDD:275368 6/21 (29%)
C2H2 Zn finger 595..615 CDD:275368 6/27 (22%)
C2H2 Zn finger 623..643 CDD:275368 5/19 (26%)
C2H2 Zn finger 652..670 CDD:275368 6/18 (33%)
C2H2 Zn finger 678..698 CDD:275368 6/20 (30%)
C2H2 Zn finger 706..726 CDD:275368 5/19 (26%)
C2H2 Zn finger 734..754 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.