DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12769 and ZNF267

DIOPT Version :9

Sequence 1:NP_001286181.1 Gene:CG12769 / 35770 FlyBaseID:FBgn0033252 Length:713 Species:Drosophila melanogaster
Sequence 2:NP_003405.4 Gene:ZNF267 / 10308 HGNCID:13060 Length:743 Species:Homo sapiens


Alignment Length:219 Identity:50/219 - (22%)
Similarity:77/219 - (35%) Gaps:63/219 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 HSPPMTFRCERC-DSFETSSRASLLLHVVQ----------CLAGQAAAAAAAAAASARLKSEDLQ 132
            |:....::||:| ||...|      ||:.|          |...:.........:....|.:.:.
Human   316 HNEEKPYKCEKCGDSLNHS------LHLTQHQIIPTEEKPCKWKECGKVFNLNCSLYLTKQQQID 374

  Fly   133 EPENMSLGHMEGGKGDGQTGNGSSSSASSSPAGNSGGGGGGNSSSRKVFECDVCNMKFSNGANMR 197
            ..||:                                           ::|..|:..|:..:|:.
Human   375 TGENL-------------------------------------------YKCKACSKSFTRSSNLI 396

  Fly   198 RHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCPICNRGFQRQIAMRAHFQNEHVG 262
            .|:..|||.|||:|:.|.|.|....:|.:|...||...||.|..|.:.|.|...:..| |..|.|
Human   397 VHQRIHTGEKPYKCKECGKAFRCSSYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQH-QTTHTG 460

  Fly   263 QHDLVKTCPLCSYRAGSMKSLRIH 286
            : .|.| |.:||.......:|.:|
Human   461 E-KLYK-CKVCSKSYARSSNLIMH 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12769NP_001286181.1 C2H2 Zn finger 183..203 CDD:275368 5/19 (26%)
zf-H2C2_2 195..218 CDD:290200 11/22 (50%)
C2H2 Zn finger 211..231 CDD:275368 6/19 (32%)
C2H2 Zn finger 239..255 CDD:275368 4/15 (27%)
C2H2 Zn finger 662..689 CDD:275371
C2H2 Zn finger 690..712 CDD:275371
ZNF267NP_003405.4 KRAB 4..64 CDD:214630
C2H2 Zn finger 269..289 CDD:275368
C2H2 Zn finger 297..316 CDD:275368 50/219 (23%)
C2H2 Zn finger 324..341 CDD:275368 9/22 (41%)
C2H2 Zn finger 353..374 CDD:275368 1/20 (5%)
COG5048 364..730 CDD:227381 39/165 (24%)
C2H2 Zn finger 382..402 CDD:275368 5/19 (26%)
C2H2 Zn finger 410..430 CDD:275368 6/19 (32%)
C2H2 Zn finger 438..458 CDD:275368 6/20 (30%)
C2H2 Zn finger 466..486 CDD:275368 5/17 (29%)
C2H2 Zn finger 494..514 CDD:275368
C2H2 Zn finger 522..542 CDD:275368
C2H2 Zn finger 550..570 CDD:275368
C2H2 Zn finger 578..598 CDD:275368
C2H2 Zn finger 606..626 CDD:275368
C2H2 Zn finger 634..654 CDD:275368
C2H2 Zn finger 662..682 CDD:275368
C2H2 Zn finger 690..710 CDD:275368
C2H2 Zn finger 718..738 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.