Sequence 1: | NP_001286181.1 | Gene: | CG12769 / 35770 | FlyBaseID: | FBgn0033252 | Length: | 713 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006229003.1 | Gene: | LOC102555672 / 102555672 | RGDID: | 7701959 | Length: | 863 | Species: | Rattus norvegicus |
Alignment Length: | 160 | Identity: | 44/160 - (27%) |
---|---|---|---|
Similarity: | 60/160 - (37%) | Gaps: | 45/160 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 SSRKVFECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFTTHTKTLPYHCP 240
Fly 241 ICNRGFQRQIAMRAHFQNEHVGQ------------------------HDLVKT--CPLCSYRAGS 279
Fly 280 MKSLRIH------------------FFNRH 291 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |