Sequence 1: | NP_001246198.1 | Gene: | CG14762 / 35768 | FlyBaseID: | FBgn0033250 | Length: | 498 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078785.1 | Gene: | LRFN3 / 79414 | HGNCID: | 28370 | Length: | 628 | Species: | Homo sapiens |
Alignment Length: | 246 | Identity: | 69/246 - (28%) |
---|---|---|---|
Similarity: | 117/246 - (47%) | Gaps: | 29/246 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
Fly 295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
Fly 359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTL-------------RIIDITDNPLN 410
Fly 411 CSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14762 | NP_001246198.1 | leucine-rich repeat | 85..105 | CDD:275380 | |
LRR_RI | 93..384 | CDD:238064 | 47/154 (31%) | ||
leucine-rich repeat | 107..129 | CDD:275380 | |||
leucine-rich repeat | 131..154 | CDD:275380 | |||
LRR_8 | 154..214 | CDD:290566 | |||
leucine-rich repeat | 155..178 | CDD:275380 | |||
leucine-rich repeat | 179..203 | CDD:275380 | |||
leucine-rich repeat | 204..227 | CDD:275380 | |||
LRR_8 | 226..286 | CDD:290566 | 18/55 (33%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 4/20 (20%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 9/22 (41%) | ||
LRR_8 | 276..335 | CDD:290566 | 20/59 (34%) | ||
leucine-rich repeat | 276..300 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 325..349 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 349..409 | CDD:290566 | 17/72 (24%) | ||
leucine-rich repeat | 350..373 | CDD:275380 | 7/22 (32%) | ||
LRFN3 | NP_078785.1 | LRR_8 | 59..119 | CDD:290566 | 18/55 (33%) |
LRR 1 | 60..83 | 4/19 (21%) | |||
LRR_RI | <63..168 | CDD:238064 | 33/105 (31%) | ||
leucine-rich repeat | 63..84 | CDD:275380 | 4/20 (20%) | ||
LRR 2 | 84..105 | 8/20 (40%) | |||
leucine-rich repeat | 85..108 | CDD:275380 | 9/22 (41%) | ||
LRR 3 | 108..129 | 5/20 (25%) | |||
leucine-rich repeat | 109..132 | CDD:275380 | 7/23 (30%) | ||
LRR 4 | 132..153 | 8/20 (40%) | |||
leucine-rich repeat | 133..157 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 157..216 | CDD:290566 | 19/59 (32%) | ||
LRR 5 | 157..178 | 8/20 (40%) | |||
leucine-rich repeat | 158..181 | CDD:275380 | 8/22 (36%) | ||
LRR 6 | 181..202 | 6/21 (29%) | |||
leucine-rich repeat | 182..205 | CDD:275380 | 7/23 (30%) | ||
LRR 7 | 205..226 | 8/23 (35%) | |||
leucine-rich repeat | 206..230 | CDD:275380 | 9/26 (35%) | ||
leucine-rich repeat | 242..253 | CDD:275378 | 3/10 (30%) | ||
TPKR_C2 | 249..>281 | CDD:301599 | 12/39 (31%) | ||
IG_like | 302..383 | CDD:214653 | |||
Ig | 310..383 | CDD:299845 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 382..430 | ||||
fn3 | 424..502 | CDD:278470 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |