DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrfn4

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001102978.1 Gene:Lrfn4 / 688721 RGDID:1585286 Length:636 Species:Rattus norvegicus


Alignment Length:244 Identity:73/244 - (29%)
Similarity:114/244 - (46%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.|:.:...||..:..|..|.|:.|.||.:.|..|..|..|.||.|:||::..:...:.
  Rat    52 ELRLADNFIQALGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSL 116

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGD--SLTFLNLQ 356
            :| ..|||:|.|..||:..|...|... |..|..||:..||   |.:..:.|.|.  :|..|||.
  Rat   117 RG-PVNLQHLILSGNQLGRIAPGAFDDFLDSLEDLDVSYNN---LRQVPWAGIGSMPALHTLNLD 177

  Fly   357 KNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR---------IIDITDNPLNCS 412
            .|.|..||..:|..|:.|..|:|.:|:|..:..|   |:....|         ::..:.|||:|:
  Rat   178 HNLIDALPPGVFAQLSQLSRLDLTSNRLATLAPD---PLFSRGRDAEASPSPLVLSFSGNPLHCN 239

  Fly   413 CELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |||.|..:|.     :.|::.....|   .:|..|.::  |:|..:..|
  Rat   240 CELLWLRRLA-----RPDDLETCASP---PTLAGRYFW--AVPEGEFSC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 53/156 (34%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
LRR_8 226..286 CDD:290566 20/55 (36%)
leucine-rich repeat 228..251 CDD:275380 5/20 (25%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 21/59 (36%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..349 CDD:275380 8/25 (32%)
LRR_8 349..409 CDD:290566 19/68 (28%)
leucine-rich repeat 350..373 CDD:275380 10/22 (45%)
Lrfn4NP_001102978.1 LRR 1 49..70 5/17 (29%)
leucine-rich repeat 50..73 CDD:275380 5/20 (25%)
PPP1R42 53..203 CDD:411060 52/153 (34%)
LRR 2 73..94 8/20 (40%)
leucine-rich repeat 74..97 CDD:275380 9/22 (41%)
LRR 3 97..118 6/20 (30%)
leucine-rich repeat 98..121 CDD:275380 7/23 (30%)
LRR 4 121..142 9/20 (45%)
leucine-rich repeat 122..146 CDD:275380 9/23 (39%)
LRR 5 146..169 8/25 (32%)
leucine-rich repeat 147..170 CDD:275380 8/25 (32%)
LRR 6 170..191 9/20 (45%)
leucine-rich repeat 171..194 CDD:275380 10/22 (45%)
LRR 7 194..215 7/23 (30%)
leucine-rich repeat 195..213 CDD:275380 6/20 (30%)
LRRCT 234..278 CDD:214507 15/53 (28%)
Ig 281..368 CDD:416386
Ig strand A 281..284 CDD:409353
Ig strand A' 288..291 CDD:409353
Ig strand B 297..305 CDD:409353
Ig strand C 311..316 CDD:409353
Ig strand C' 319..321 CDD:409353
Ig strand D 327..331 CDD:409353
Ig strand E 334..338 CDD:409353
Ig strand F 348..355 CDD:409353
Ig strand G 358..368 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..585
PDZ-binding 633..636
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.