DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Aspn

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001165952.1 Gene:Aspn / 66695 MGIID:1913945 Length:373 Species:Mus musculus


Alignment Length:264 Identity:74/264 - (28%)
Similarity:133/264 - (50%) Gaps:18/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 FHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNI 217
            |...:::|.:|||..|..|.|:||.:|..|.|..||:|:|.|:.|...: .::||.|..|.|:.|
Mouse    95 FDTRMVDLQNNKIKEIKENDFKGLTSLYALILNNNKLTKIHPKTFLTTK-KLRRLYLSHNQLSEI 158

  Fly   218 PQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITT--VPANVFSHLTLLNSLE 280
            |   |::..:|.:|.|.:||::.|.:..|:|:.:|..|.::.|.:..  :....|..:|:.: :.
Mouse   159 P---LNLPKSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSANPLENNGIEPGAFEGVTVFH-IR 219

  Fly   281 LEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTG 345
            :...|::.|.    |||...|..|.|..|:|.|:..|.|:....|:.|.|.||.|..:....|..
Mouse   220 IAEAKLTSIP----KGLPPTLLELHLDFNKISTVELEDLKRYRELQRLGLGNNRITDIENGTFAN 280

  Fly   346 FGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR-----IIDIT 405
            . ..:..::|:.|.:|.:||.| :.|..|:.:.|..|.:.::..:...|.:..::     .|.:.
Mouse   281 I-PRVREIHLEHNKLKKIPSGL-QELKYLQIIFLHYNSIAKVGVNDFCPTVPKMKKSLYSAISLF 343

  Fly   406 DNPL 409
            :||:
Mouse   344 NNPM 347

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 70/232 (30%)
leucine-rich repeat 107..129 CDD:275380