DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and NYX

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001365406.2 Gene:NYX / 60506 HGNCID:8082 Length:476 Species:Homo sapiens


Alignment Length:418 Identity:102/418 - (24%)
Similarity:166/418 - (39%) Gaps:82/418 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VVLLLQVLVMDQVLGQGPPQ-------TQVCPEQSEIAPCICTVKKNGLDILCETTDLAHITKSM 73
            :||||..:|:      |.|.       .:.||     |.|.|:..:.|..:.|:...|..:.   
Human     2 LVLLLHAVVL------GLPSAWAVGACARACP-----AACACSTVERGCSVRCDRAGLLRVP--- 52

  Fly    74 GTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSL 138
                                                               :.|......:|:..
Human    53 ---------------------------------------------------AELPCEAVSIDLDR 66

  Fly   139 NQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYEN-KITQIDPEAFRGLED 202
            |.::.:..:|...|..|..|:|.||.::.|...||:||..|..|.|..| .:..:....|..| .
Human    67 NGLRFLGERAFGTLPSLRRLSLRHNNLSFITPGAFKGLPRLAELRLAHNGDLRYLHARTFAAL-S 130

  Fly   203 HIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPA 267
            .::||:|....|.::|::.|:.|..|::|...:|..|.: .|...||.:|....|....|..|.:
Human   131 RLRRLDLAACRLFSVPERLLAELPALRELAAFDNLFRRV-PGALRGLANLTHAHLERGRIEAVAS 194

  Fly   268 NVFSHLTLLNSLELEGNKISVIDKDAFK--GLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDL 330
            :....|..|.||.|:.|::..:...||.  |:   |::|.|.||.:..:|::|.|.|.|||.|:|
Human   195 SSLQGLRRLRSLSLQANRVRAVHAGAFGDCGV---LEHLLLNDNLLAELPADAFRGLRRLRTLNL 256

  Fly   331 RNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPV 395
            ..|.::.:|...|....: |..|.|.:|.|..:....|:||:.|..|:|..|:|..:.....:|.
Human   257 GGNALDRVARAWFADLAE-LELLYLDRNSIAFVEEGAFQNLSGLLALHLNGNRLTVLAWVAFQPG 320

  Fly   396 IDTLRIIDITDNPLNCSCELTWFPKLLE 423
            ....|:. :..||..|.|.|.|....:|
Human   321 FFLGRLF-LFRNPWCCDCRLEWLRDWME 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 0/19 (0%)
LRR_RI 93..384 CDD:238064 77/293 (26%)
leucine-rich repeat 107..129 CDD:275380 1/21 (5%)
leucine-rich repeat 131..154 CDD:275380 4/22 (18%)
LRR_8 154..214 CDD:290566 19/60 (32%)
leucine-rich repeat 155..178 CDD:275380 10/22 (45%)
leucine-rich repeat 179..203 CDD:275380 6/24 (25%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
LRR_8 226..286 CDD:290566 17/59 (29%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 276..335 CDD:290566 23/60 (38%)
leucine-rich repeat 276..300 CDD:275380 8/25 (32%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 16/59 (27%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
NYXNP_001365406.2 LRR_8 61..115 CDD:404697 17/53 (32%)
leucine-rich repeat 63..82 CDD:275380 4/18 (22%)
leucine-rich repeat 83..106 CDD:275380 10/22 (45%)
leucine-rich repeat 107..131 CDD:275380 6/24 (25%)
leucine-rich repeat 132..155 CDD:275380 7/22 (32%)
PPP1R42 150..310 CDD:411060 51/164 (31%)
leucine-rich repeat 156..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..202 CDD:275380 5/22 (23%)
leucine-rich repeat 203..226 CDD:275380 7/22 (32%)
LRR_8 227..285 CDD:404697 21/58 (36%)
leucine-rich repeat 227..250 CDD:275380 9/22 (41%)
leucine-rich repeat 251..274 CDD:275380 7/22 (32%)
leucine-rich repeat 275..296 CDD:275380 6/20 (30%)
leucine-rich repeat 323..335 CDD:275378 3/12 (25%)
LRRCT 331..>365 CDD:214507 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D277227at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.