DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lingo4b

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001082850.1 Gene:lingo4b / 559074 ZFINID:ZDB-GENE-091214-3 Length:604 Species:Danio rerio


Alignment Length:510 Identity:123/510 - (24%)
Similarity:206/510 - (40%) Gaps:109/510 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CPEQSEIAPCICTVKKNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLA 103
            ||::       |:..::.|::.|.:..|..:.:.:.|                            
Zfish    29 CPQR-------CSCSRDPLEVNCSSRHLTAVPEGLPT---------------------------- 58

  Fly   104 LDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVI 168
             :.:.|.:..:.|..:.....||| :.|..||:|.|.:..:..:..|.|.:|..|.:.:|::.::
Zfish    59 -NAKRLDLSGNQLKTLARRQFSSL-SKLEDLDLSENIISMIEVETFQGLKNLRYLRIKNNRLKIL 121

  Fly   169 HNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEI 233
            ....|.||..|..|.:.||:|.......||.: .::::|:.|.|||..|.|:|...|..||:|.:
Zfish   122 PVGVFSGLSNLRRLDISENEILVFLDYTFRDM-INLQQLDAGENDLVFISQRAFVGLQALKELNV 185

  Fly   234 QENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLE-LEGNKISVIDKDAFKGL 297
            ..:.:.:|.......||||..|.|....|:.:|.|.|..|..|.:|: |..:.:.:::.::..||
Zfish   186 DRSNLTSIPTEALSQLQSLTKLRLRKLTISVLPNNAFRRLHQLRTLQILHWSSLEMLNSNSLVGL 250

  Fly   298 EENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQK----- 357
              ||..|.|.:..:..||...||.|..|::|||..|.|..:..:.   .||   .|.||:     
Zfish   251 --NLTTLVLTNCNLSAIPYSPLRHLAYLQYLDLSYNPITSIQGNL---LGD---LLRLQELHLVG 307

  Fly   358 -NDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPV--IDTLRIIDITDNPLNCSCELTWFP 419
             |.:::.|. .|..|:....||:.:|:|..:.:.....|  :.|||   :..|||.|.|.|.|  
Zfish   308 GNLLRIEPG-AFRGLSRFRLLNVSSNRLSTLEESAFHSVGNLQTLR---LDRNPLACDCRLLW-- 366

  Fly   420 KLLEDLKNKD-DEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC----------------AGLNVS 467
             ::...:..| |.......||.|.....|::....:|. ...|                .|:.|.
Zfish   367 -VMRRRRRLDFDGRQPTCSPLNHQRKAFRDFSEAELPV-VFTCRQAQILNRQLQDISVIEGMRVH 429

  Fly   468 --------PSP------------TSGGLMRILQVNIL----AQIA-----VCSVA 493
                    |||            :|.|.:|:|....|    ||:.     :||.|
Zfish   430 FDCKADGYPSPSITWLSAQQSALSSAGRVRVLTNGSLQISYAQVQDSGTYLCSAA 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 0/19 (0%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
LRR <131..410 CDD:443914 83/287 (29%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 155..178 CDD:275380 6/22 (27%)
leucine-rich repeat 179..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 9/22 (41%)
leucine-rich repeat 228..251 CDD:275380 5/22 (23%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
leucine-rich repeat 276..300 CDD:275380 5/24 (21%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 7/28 (25%)
lingo4bNP_001082850.1 LRRNT 28..61 CDD:214470 7/67 (10%)
leucine-rich repeat 41..62 CDD:275380 3/49 (6%)
LRR <58..>315 CDD:443914 76/295 (26%)
leucine-rich repeat 63..83 CDD:275380 5/20 (25%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
leucine-rich repeat 108..131 CDD:275380 6/22 (27%)
leucine-rich repeat 132..155 CDD:275380 7/23 (30%)
leucine-rich repeat 156..179 CDD:275380 9/22 (41%)
leucine-rich repeat 180..203 CDD:275380 5/22 (23%)
leucine-rich repeat 204..251 CDD:275380 13/48 (27%)
leucine-rich repeat 228..250 CDD:275380 3/21 (14%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
leucine-rich repeat 276..297 CDD:275380 8/26 (31%)
LRR_8 299..358 CDD:404697 15/62 (24%)
leucine-rich repeat 300..321 CDD:275380 5/21 (24%)
leucine-rich repeat 324..344 CDD:275380 4/19 (21%)
Ig 410..498 CDD:472250 15/75 (20%)
Ig strand B 428..432 CDD:409353 1/3 (33%)
Ig strand C 441..445 CDD:409353 0/3 (0%)
Ig strand E 464..468 CDD:409353 1/3 (33%)
Ig strand F 478..483 CDD:409353 1/4 (25%)
Ig strand G 491..494 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.