DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and LRRN3

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001093128.1 Gene:LRRN3 / 54674 HGNCID:17200 Length:708 Species:Homo sapiens


Alignment Length:413 Identity:103/413 - (24%)
Similarity:167/413 - (40%) Gaps:98/413 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAF 173
            |.:..:::|.||.:  :.....||.||:|.|.:.:|.:..::.:..||.:.|..||:|.:.....
Human    74 LLLQTNNIAKIEYS--TDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCL 136

  Fly   174 EGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKI 238
            ..|..|:.|.:..|.::.|.|.||.||. ::.||:|..|.|..|..|....|..|:.|.|.||.|
Human   137 SELSNLQELYINHNLLSTISPGAFIGLH-NLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPI 200

  Fly   239 RTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQY 303
            ..|.:.:|:.|.:|.||::|...:|.:|.|                        |..|| |||:.
Human   201 IRIKDMNFKPLINLRSLVIAGINLTEIPDN------------------------ALVGL-ENLES 240

  Fly   304 LRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLL- 367
            :...||::..:|..||:.:..|:.|||..|.||.:..      ||....|:|::..|..:|.|: 
Human   241 ISFYDNRLIKVPHVALQKVVNLKFLDLNKNPINRIRR------GDFSNMLHLKELGINNMPELIS 299

  Fly   368 ------------------------------FENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRII 402
                                          |..|..||:|.|.:|.|..:....:|. :..|:.|
Human   300 IDSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNSNALSALYHGTIES-LPNLKEI 363

  Fly   403 DITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHCAGLNVS 467
            .|..||:.|.|.:.|.                      :|:..|    ::.|..:.:.|    |.
Human   364 SIHSNPIRCDCVIRWM----------------------NMNKTN----IRFMEPDSLFC----VD 398

  Fly   468 PSPTSGGLMRILQVNILAQIAVC 490
            |....|  ..:.||:....:.:|
Human   399 PPEFQG--QNVRQVHFRDMMEIC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 83/305 (27%)
leucine-rich repeat 107..129 CDD:275380 4/19 (21%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
LRR_8 154..214 CDD:290566 20/59 (34%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 9/23 (39%)
leucine-rich repeat 204..227 CDD:275380 8/22 (36%)
LRR_8 226..286 CDD:290566 16/59 (27%)
leucine-rich repeat 228..251 CDD:275380 9/22 (41%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 16/58 (28%)
leucine-rich repeat 276..300 CDD:275380 3/23 (13%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..349 CDD:275380 8/23 (35%)
LRR_8 349..409 CDD:290566 18/90 (20%)
leucine-rich repeat 350..373 CDD:275380 7/53 (13%)
LRRN3NP_001093128.1 LRRNT 28..72 CDD:214470
LRR 1 70..91 4/18 (22%)
leucine-rich repeat 72..93 CDD:275380 4/20 (20%)
LRR <75..355 CDD:227223 83/313 (27%)
LRR 2 93..114 7/20 (35%)
leucine-rich repeat 94..117 CDD:275380 7/22 (32%)
LRR 3 117..138 6/20 (30%)
leucine-rich repeat 118..141 CDD:275380 7/22 (32%)
LRR 4 141..162 7/20 (35%)
leucine-rich repeat 142..165 CDD:275380 9/23 (39%)
LRR 5 165..186 7/20 (35%)
leucine-rich repeat 166..189 CDD:275380 8/22 (36%)
LRR 6 189..210 8/20 (40%)
leucine-rich repeat 190..213 CDD:275380 9/22 (41%)
LRR 7 213..234 8/44 (18%)
leucine-rich repeat 214..237 CDD:275380 10/47 (21%)
LRR 8 237..258 7/20 (35%)
leucine-rich repeat 238..261 CDD:275380 6/22 (27%)
LRR 9 261..282 9/26 (35%)
leucine-rich repeat 262..285 CDD:275380 9/28 (32%)
LRR 10 285..304 4/18 (22%)
leucine-rich repeat 286..310 CDD:275380 4/23 (17%)
LRR 11 310..332 1/21 (5%)
leucine-rich repeat 311..333 CDD:275380 1/21 (5%)
LRR 12 335..358 7/23 (30%)
leucine-rich repeat 336..359 CDD:275380 7/23 (30%)
PCC 341..>442 CDD:188093 22/112 (20%)
Ig 437..513 CDD:325142
fn3 526..593 CDD:306538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X351
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.