DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and TLR9

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_059138.1 Gene:TLR9 / 54106 HGNCID:15633 Length:1032 Species:Homo sapiens


Alignment Length:360 Identity:94/360 - (26%)
Similarity:153/360 - (42%) Gaps:70/360 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTV 144
            |.:.|.|.|..|||..:|..:|..|.  ||     ....:..|.:|.          ::|..:.:
Human   471 STLNFTLDLSRNNLVTVQPEMFAQLS--HL-----QCLRLSHNCISQ----------AVNGSQFL 518

  Fly   145 PSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDH------ 203
            |...||      :|:|:|||:.:.|.::|..|..||.|.|..|.    .|...:|:..:      
Human   519 PLTGLQ------VLDLSHNKLDLYHEHSFTELPRLEALDLSYNS----QPFGMQGVGHNFSFVAH 573

  Fly   204 ---IKRLNLGGNDL-TNIPQKALSILSTLKKLEIQENKIRTI-SEGD-----FEGLQSLDSLILA 258
               ::.|:|..|:: :.:.|:..|  ::|:.|:...|.:..: :|||     |:||..|..|.|:
Human   574 LRTLRHLSLAHNNIHSQVSQQLCS--TSLRALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLS 636

  Fly   259 HNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLH 323
            .|.:         |..|..:|               :.|.::||.|||.||.:......:|..|.
Human   637 QNRL---------HTLLPQTL---------------RNLPKSLQVLRLRDNYLAFFKWWSLHFLP 677

  Fly   324 RLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIP 388
            :|..|||..|.:..|...:... |..|..|::..|.|..:....|.....|..|||..|.|:.:.
Human   678 KLEVLDLAGNQLKALTNGSLPA-GTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVD 741

  Fly   389 QDIMEPVIDTLRIIDITDNPLNCSCELTWFPKLLE 423
            .....|:...|:|:|::.|||:|:|...:...|||
Human   742 HSWFGPLASALQILDVSANPLHCACGAAFMDFLLE 776

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 7/19 (37%)
leucine-rich repeat 107..129 CDD:275380 4/21 (19%)
LRR <131..410 CDD:443914 74/294 (25%)
leucine-rich repeat 131..154 CDD:275380 4/22 (18%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 5/23 (22%)
leucine-rich repeat 228..251 CDD:275380 9/28 (32%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
leucine-rich repeat 276..300 CDD:275380 2/23 (9%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 5/22 (23%)
TLR9NP_059138.1 leucine-rich repeat 43..64 CDD:275380
LRR 1 62..85
LRR_8 64..135 CDD:404697
leucine-rich repeat 65..88 CDD:275380
LRR 2 87..110
leucine-rich repeat 89..124 CDD:275380
LRR 113..504 CDD:443914 12/39 (31%)
LRR 3 122..147
leucine-rich repeat 125..144 CDD:275380
leucine-rich repeat 145..168 CDD:275380
LRR 4 150..166
LRR 5 167..190
leucine-rich repeat 169..200 CDD:275380
LRR 6 198..221
leucine-rich repeat 201..221 CDD:275380
leucine-rich repeat 222..245 CDD:275380
LRR 7 223..242
LRR 8 243..268
leucine-rich repeat 246..285 CDD:275380
LRR 9 283..306
leucine-rich repeat 286..307 CDD:275380
LRR 10 308..332
leucine-rich repeat 310..335 CDD:275380
LRR 11 333..356
leucine-rich repeat 336..365 CDD:275380
LRR 12 363..386
leucine-rich repeat 366..392 CDD:275380
LRR 13 390..413
leucine-rich repeat 393..416 CDD:275380
LRR 14 415..440