DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and alrm

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster


Alignment Length:377 Identity:92/377 - (24%)
Similarity:147/377 - (38%) Gaps:66/377 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IRHLTIHNSSLAAIEENALSSLGAG----LTQLDVSLNQMKTVPSQALQHLFHLL--------IL 158
            :|.|.:.:...|.|..|.:  :|..    |:|..:....|.|..:.::..:.|||        :|
  Fly    32 LRRLWLQDHCSAGICTNVV--IGRSDYVILSQAPIGGTTMLTFLNSSIAKIPHLLFDTFPDLQVL 94

  Fly   159 NLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALS 223
            .:.:..:.......|||...|..|.|..|::..|....|.| .|::..|:|.||.|..:...:..
  Fly    95 RMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLG-ADNLATLHLQGNQLKQLGNHSFH 158

  Fly   224 ILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISV 288
            .|..:|:|.:.||::..||.|.|.|::.|..|.||.|.:..:|..||.....|..|.|..|:.:.
  Fly   159 ALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTA 223

  Fly   289 IDKDAFK--------GLEENL-QYLRLGDNQI-----HTIPSEALRPLHRLRHLDLRNNNI---- 335
            .:.:..|        .:..|: |.|.|....:     |:.....|.....:..|||.||::    
  Fly   224 FESELLKLQPVFTQLDISGNIFQELTLNFTMLDVAIAHSCDLRRLTVYGVIHELDLHNNSLREMP 288

  Fly   336 ------NVLAED---------------AFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNL 379
                  ||.:.|               .||    ||..|||.......||..||:..:.|:.|::
  Fly   289 HIPLAANVSSLDLSHNPLGNLQGNPLRRFT----SLLRLNLSATGAHELPEGLFKKQSHLQMLDI 349

  Fly   380 QNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPKLLED--LKNKD 429
            ..|.:..:...|.:. :..|:......|..||.     |.:||..  :|.||
  Fly   350 SGNSIYSLKITIFDS-LKALQYFYFQQNNWNCD-----FLQLLMSSFVKRKD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 81/328 (25%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
leucine-rich repeat 131..154 CDD:275380 4/22 (18%)
LRR_8 154..214 CDD:290566 19/67 (28%)
leucine-rich repeat 155..178 CDD:275380 6/30 (20%)
leucine-rich repeat 179..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
LRR_8 226..286 CDD:290566 21/59 (36%)
leucine-rich repeat 228..251 CDD:275380 9/22 (41%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
LRR_8 276..335 CDD:290566 16/72 (22%)
leucine-rich repeat 276..300 CDD:275380 5/31 (16%)
leucine-rich repeat 301..324 CDD:275380 5/28 (18%)
leucine-rich repeat 325..349 CDD:275380 10/48 (21%)
LRR_8 349..409 CDD:290566 15/59 (25%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 69/274 (25%)
LRR_8 91..149 CDD:290566 16/58 (28%)
leucine-rich repeat 91..114 CDD:275380 4/22 (18%)
leucine-rich repeat 115..138 CDD:275380 7/23 (30%)
LRR_8 138..197 CDD:290566 20/58 (34%)
leucine-rich repeat 139..162 CDD:275380 6/22 (27%)
leucine-rich repeat 163..186 CDD:275380 9/22 (41%)
LRR_8 185..243 CDD:290566 13/57 (23%)
leucine-rich repeat 187..210 CDD:275380 8/22 (36%)
leucine-rich repeat 211..283 CDD:275380 15/71 (21%)
leucine-rich repeat 284..319 CDD:275380 5/38 (13%)
LRR_8 318..377 CDD:290566 15/63 (24%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..365 CDD:275380 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.