DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and 2mit

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster


Alignment Length:375 Identity:111/375 - (29%)
Similarity:173/375 - (46%) Gaps:43/375 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALD----IRHLTIHNSSLAAIEEN-AL 124
            ||.....:.|..||...:|..:.|..|.|..      |:||    :|.|.:.|:||..|..: |.
  Fly   105 DLRTFNSTGGQWKGDFQVITAMDLSSNQLES------LSLDNFNQLRQLDLGNNSLEVIPLSLAD 163

  Fly   125 SSLGAGLTQLDVSLNQMKTVPSQAL-QHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENK 188
            :::......||:|.|:...:.:... |.|..|..|||.||::..|...:|..|..|:.|.|..|.
  Fly   164 TNMSLPFVTLDLSCNKFSQISTSFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNN 228

  Fly   189 ITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDF------- 246
            |:.||.|.|..| .:::.|:|..|.|:....:||..:..|..|.|..|....::..:|       
  Fly   229 ISDIDYETFLAL-PNLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLK 292

  Fly   247 ------EGL--------QSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGL 297
                  .||        ||:.:|.|:.|.:..:.........||..|:|..::|:.::.||. |.
  Fly   293 ELDASGTGLCQVPAALAQSVRTLKLSDNWLKAINCGDMDSYPLLQYLDLSHSRIAQVEDDAL-GR 356

  Fly   298 EENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIKV 362
            .|.|:.|.|..|.:..:|| :|.|  .|.||.|::|.|..|...||.|. .:|..|:|..|.:..
  Fly   357 LELLESLFLDRNLLMRVPS-SLPP--SLEHLFLQHNQIMELPPQAFVGL-VNLQTLDLSNNRLIF 417

  Fly   363 LPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCS 412
            ||.|   :|..|.||||:::.::.:.|.|:. .:..||.:.:.|||:.||
  Fly   418 LPPL---SLPKLLTLNLESSGVESVSQSIVH-TLPQLRDLLLEDNPIKCS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 4/19 (21%)
LRR_RI 93..384 CDD:238064 94/317 (30%)
leucine-rich repeat 107..129 CDD:275380 7/22 (32%)
leucine-rich repeat 131..154 CDD:275380 6/23 (26%)
LRR_8 154..214 CDD:290566 22/59 (37%)
leucine-rich repeat 155..178 CDD:275380 9/22 (41%)
leucine-rich repeat 179..203 CDD:275380 10/23 (43%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
LRR_8 226..286 CDD:290566 16/80 (20%)
leucine-rich repeat 228..251 CDD:275380 7/43 (16%)
leucine-rich repeat 252..275 CDD:275380 3/22 (14%)
LRR_8 276..335 CDD:290566 21/58 (36%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 10/23 (43%)
LRR_8 349..409 CDD:290566 19/59 (32%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 63/238 (26%)
leucine-rich repeat 124..143 CDD:275380 6/24 (25%)
leucine-rich repeat 144..167 CDD:275380 7/22 (32%)
leucine-rich repeat 172..194 CDD:275380 6/21 (29%)
LRR_8 193..253 CDD:290566 22/60 (37%)
leucine-rich repeat 195..218 CDD:275380 9/22 (41%)
leucine-rich repeat 219..242 CDD:275380 10/23 (43%)
LRR_8 241..301 CDD:290566 11/59 (19%)
leucine-rich repeat 243..311 CDD:275380 13/67 (19%)
leucine-rich repeat 312..335 CDD:275380 3/22 (14%)
LRR_8 334..415 CDD:290566 31/85 (36%)
leucine-rich repeat 336..359 CDD:275380 7/23 (30%)
leucine-rich repeat 360..380 CDD:275380 8/22 (36%)
LRR_8 379..460 CDD:290566 30/87 (34%)
LRR_4 379..>415 CDD:289563 15/38 (39%)
leucine-rich repeat 381..404 CDD:275380 10/23 (43%)
leucine-rich repeat 405..449 CDD:275380 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.