DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and CG7800

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:421 Identity:107/421 - (25%)
Similarity:173/421 - (41%) Gaps:94/421 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 CETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLT-IHNSSLAAIEENAL 124
            |::.|.     :|..| .:.|.:..|:||..||        |.|...|.: ..|..:..:..|.:
  Fly    73 CDSPDF-----TMNDL-NQLPYLTSLQLRRGNL--------LGLHDEHFSKWPNMKILMLGGNNI 123

  Fly   125 SSLG----AGLTQ---LDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEIL 182
            :.|.    .||.|   |.:..|.::.:|....|:|..||.|:|:.|:|..:|.|.|.|:..||:|
  Fly   124 TRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGVPKLEML 188

  Fly   183 TLYENKITQIDPEAFRGLED----------HIKRLNLGGND---LTNIPQKALSILSTLKKLEIQ 234
            .|..|.:|.|.|.:.:.|.:          .:..|:|.|..   |.|...:.|.||.::.||:.:
  Fly   189 LLNGNPLTWIAPTSLKSLSNLRLLDMSNCGPLPDLSLPGAHTLILDNSGVQRLDILGSVHKLQAR 253

  Fly   235 ENKIRTISEGDFEGLQSLDSLILAHNMITT--VPANVFSHLTLLNSLELEGNKISVI-----DKD 292
            :|.|..|...|...:..||   |..|::|.  :| .:.:.:..|..|:|..|.|.:.     |..
  Fly   254 KNHITEIKLPDKSSVIELD---LHSNLLTATDIP-KLLTGMWRLQRLDLSENIIGIYAAAGSDNT 314

  Fly   293 AFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNI----NVLAEDAFTGFGDSLTFL 353
            :...:..||.|:.|..|::..:..::..|..||.|||...|.|    .|..::||     :|..|
  Fly   315 SELFILPNLMYMNLSANRLTRLHFDSPIPWERLTHLDASYNRIYAPAKVGIDEAF-----NLQSL 374

  Fly   354 NLQKNDIKVLPSLLFENLNSLETLNLQNNKLQ------------RIPQDIME------------- 393
            :|:.|.|.......::...||:.:.|.:||.|            .|..:::|             
  Fly   375 HLEGNYINNFELTPWKPHPSLKEVALYDNKFQPKGYKNITKFFNEIGVNVLEKTQYSQSNNTTPT 439

  Fly   394 --PVI------------DTLRIIDITDNPLN 410
              |.|            ||.:.||...|||:
  Fly   440 CKPCIPDARDFPTSISADTNQTIDTKVNPLS 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 6/19 (32%)
LRR_RI 93..384 CDD:238064 85/322 (26%)
leucine-rich repeat 107..129 CDD:275380 4/26 (15%)
leucine-rich repeat 131..154 CDD:275380 7/25 (28%)
LRR_8 154..214 CDD:290566 22/72 (31%)
leucine-rich repeat 155..178 CDD:275380 10/22 (45%)
leucine-rich repeat 179..203 CDD:275380 9/33 (27%)
leucine-rich repeat 204..227 CDD:275380 8/25 (32%)
LRR_8 226..286 CDD:290566 16/61 (26%)
leucine-rich repeat 228..251 CDD:275380 6/22 (27%)
leucine-rich repeat 252..275 CDD:275380 6/24 (25%)
LRR_8 276..335 CDD:290566 18/63 (29%)
leucine-rich repeat 276..300 CDD:275380 6/28 (21%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..349 CDD:275380 9/27 (33%)
LRR_8 349..409 CDD:290566 20/98 (20%)
leucine-rich repeat 350..373 CDD:275380 5/22 (23%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380
leucine-rich repeat 65..85 CDD:275380 4/17 (24%)
LRR_8 87..147 CDD:290566 17/67 (25%)
leucine-rich repeat 89..112 CDD:275380 8/30 (27%)
leucine-rich repeat 113..136 CDD:275380 4/22 (18%)
LRR_RI <131..334 CDD:238064 58/206 (28%)
leucine-rich repeat 137..160 CDD:275380 5/22 (23%)
LRR_8 140..195 CDD:290566 20/54 (37%)
leucine-rich repeat 161..184 CDD:275380 10/22 (45%)
leucine-rich repeat 185..208 CDD:275380 9/22 (41%)
leucine-rich repeat 209..246 CDD:275380 8/36 (22%)
leucine-rich repeat 247..267 CDD:275380 6/19 (32%)
leucine-rich repeat 268..292 CDD:275380 6/27 (22%)
leucine-rich repeat 293..322 CDD:275380 6/28 (21%)
leucine-rich repeat 395..406 CDD:275378 4/10 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.