DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrfn1

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_956909.1 Gene:lrfn1 / 393587 ZFINID:ZDB-GENE-040426-1227 Length:584 Species:Danio rerio


Alignment Length:220 Identity:67/220 - (30%)
Similarity:110/220 - (50%) Gaps:18/220 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.|..:...||..:.||..|.|:.|.|:.:..:.|..|..|.:|.::||::|||:.|..
Zfish    55 ELRLTDNFITAVRRKDFLNMTSLVHLTLSRNTISQIAPHAFMGLKSLRALHMDGNRLSVINSDQL 119

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
            ||| .||::|.||:||||.|...:... :..:..|||..||:..|..:|.... .::..|.|..|
Zfish   120 KGL-MNLRHLILGNNQIHHIEESSFDEFVATIEDLDLSYNNLRTLPWEAIARM-TNINTLTLDHN 182

  Fly   359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQD--------IMEPVIDTLRIIDIT--DNPLNCSC 413
            .|..:....|..|..|..|::.:|:||.:|.|        :.||...:...:.::  .|||:|:|
Zfish   183 LIDHIGVGTFTLLTKLVRLDMTSNRLQTLPPDTLFQHAQVLSEPKTSSSSRLTVSFGGNPLHCNC 247

  Fly   414 ELTWFPKLLEDLKNKDDEMSQKKKP 438
            ||.|..:|     .::|::.....|
Zfish   248 ELLWLRRL-----TREDDLETCASP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 50/154 (32%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
LRR_8 226..286 CDD:290566 17/55 (31%)
leucine-rich repeat 228..251 CDD:275380 5/20 (25%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 25/59 (42%)
leucine-rich repeat 276..300 CDD:275380 11/23 (48%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 16/69 (23%)
leucine-rich repeat 350..373 CDD:275380 6/22 (27%)
lrfn1NP_956909.1 LRR 1 52..73 5/17 (29%)
LRR_8 55..111 CDD:290566 17/55 (31%)
leucine-rich repeat 55..76 CDD:275380 5/20 (25%)
LRR_RI <71..>208 CDD:238064 46/138 (33%)
LRR 2 76..97 7/20 (35%)
leucine-rich repeat 77..100 CDD:275380 7/22 (32%)
LRR_8 99..160 CDD:290566 25/61 (41%)
LRR 3 100..121 8/20 (40%)
leucine-rich repeat 101..124 CDD:275380 11/23 (48%)
LRR 4 124..145 10/20 (50%)
leucine-rich repeat 125..148 CDD:275380 9/22 (41%)
LRR 5 149..170 7/20 (35%)
leucine-rich repeat 150..173 CDD:275380 7/23 (30%)
LRR_8 153..208 CDD:290566 16/55 (29%)
LRR 6 173..194 5/20 (25%)
leucine-rich repeat 174..197 CDD:275380 6/22 (27%)
LRR 7 197..218 7/20 (35%)
leucine-rich repeat 198..222 CDD:275380 7/23 (30%)
LRRCT 241..>270 CDD:214507 11/32 (34%)
IG_like 299..375 CDD:214653
Ig_2 303..376 CDD:143241
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 393..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 539..564
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I12162
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.