Sequence 1: | NP_001246198.1 | Gene: | CG14762 / 35768 | FlyBaseID: | FBgn0033250 | Length: | 498 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_956909.1 | Gene: | lrfn1 / 393587 | ZFINID: | ZDB-GENE-040426-1227 | Length: | 584 | Species: | Danio rerio |
Alignment Length: | 220 | Identity: | 67/220 - (30%) |
---|---|---|---|
Similarity: | 110/220 - (50%) | Gaps: | 18/220 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
Fly 295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
Fly 359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQD--------IMEPVIDTLRIIDIT--DNPLNCSC 413
Fly 414 ELTWFPKLLEDLKNKDDEMSQKKKP 438 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14762 | NP_001246198.1 | leucine-rich repeat | 85..105 | CDD:275380 | |
LRR_RI | 93..384 | CDD:238064 | 50/154 (32%) | ||
leucine-rich repeat | 107..129 | CDD:275380 | |||
leucine-rich repeat | 131..154 | CDD:275380 | |||
LRR_8 | 154..214 | CDD:290566 | |||
leucine-rich repeat | 155..178 | CDD:275380 | |||
leucine-rich repeat | 179..203 | CDD:275380 | |||
leucine-rich repeat | 204..227 | CDD:275380 | |||
LRR_8 | 226..286 | CDD:290566 | 17/55 (31%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 276..335 | CDD:290566 | 25/59 (42%) | ||
leucine-rich repeat | 276..300 | CDD:275380 | 11/23 (48%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 325..349 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 349..409 | CDD:290566 | 16/69 (23%) | ||
leucine-rich repeat | 350..373 | CDD:275380 | 6/22 (27%) | ||
lrfn1 | NP_956909.1 | LRR 1 | 52..73 | 5/17 (29%) | |
LRR_8 | 55..111 | CDD:290566 | 17/55 (31%) | ||
leucine-rich repeat | 55..76 | CDD:275380 | 5/20 (25%) | ||
LRR_RI | <71..>208 | CDD:238064 | 46/138 (33%) | ||
LRR 2 | 76..97 | 7/20 (35%) | |||
leucine-rich repeat | 77..100 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 99..160 | CDD:290566 | 25/61 (41%) | ||
LRR 3 | 100..121 | 8/20 (40%) | |||
leucine-rich repeat | 101..124 | CDD:275380 | 11/23 (48%) | ||
LRR 4 | 124..145 | 10/20 (50%) | |||
leucine-rich repeat | 125..148 | CDD:275380 | 9/22 (41%) | ||
LRR 5 | 149..170 | 7/20 (35%) | |||
leucine-rich repeat | 150..173 | CDD:275380 | 7/23 (30%) | ||
LRR_8 | 153..208 | CDD:290566 | 16/55 (29%) | ||
LRR 6 | 173..194 | 5/20 (25%) | |||
leucine-rich repeat | 174..197 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 197..218 | 7/20 (35%) | |||
leucine-rich repeat | 198..222 | CDD:275380 | 7/23 (30%) | ||
LRRCT | 241..>270 | CDD:214507 | 11/32 (34%) | ||
IG_like | 299..375 | CDD:214653 | |||
Ig_2 | 303..376 | CDD:143241 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 393..414 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 539..564 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 45 | 1.000 | Domainoid score | I12162 |
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |