DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and CG4781

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:412 Identity:91/412 - (22%)
Similarity:156/412 - (37%) Gaps:120/412 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LPKLQGFVFLALDIRHLTIHNSSLAAIEEN-----------------------ALSSLGAGLTQL 134
            |..::|..|..|..:.|..|.:....|:..                       :.|..|....::
  Fly     4 LEVIRGLTFALLLTQLLAAHVARAEVIDAEETDRFCYPESSKNSRRSCECSNVSASPWGNRALRI 68

  Fly   135 DVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRG 199
            |.|....|......|..|: :..|:|:.|           .|:::.|.|                
  Fly    69 DCSYKDYKVADLSLLLPLY-IDSLDLSWN-----------ALDSVPIFT---------------- 105

  Fly   200 LEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITT 264
             .|.:.:|||..|:::.:.......|::|::|.:..|.|..:..|.|:||..|..|.||||.:..
  Fly   106 -SDSLHQLNLRHNNISQLVSGNFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHL 169

  Fly   265 VPANVFSHLTLLNSLELEGN-KISVIDKDAFKGLEEN-----------------------LQYLR 305
            :|.::|:.|.:|.:|::..| :.:....|.:.||..|                       |:.|.
  Fly   170 LPGHLFAPLLVLGTLDISWNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELS 234

  Fly   306 LGDNQIHTIPSEALRPLHRLRHLDLRNNNI-NVLAEDAFTGFGDSLTFL-NLQKNDIKVLPSLLF 368
            |..||:..||::....|.|   ||:.:|.: .:|.||.     .:||.: .|...|:.||..::.
  Fly   235 LRRNQLKRIPTQLPETLLR---LDISDNLLEELLPEDT-----ANLTQVRQLFIEDMPVLQRVVA 291

  Fly   369 ENL---NSLETLNLQNNK-LQRIPQDIMEPVIDT------------------------------L 399
            .:|   :.||||:.||:: |..:..:...|::.|                              |
  Fly   292 NSLTHVDVLETLSFQNSRQLSHLDAEAFGPIMTTPTKKRALRSLSFRGTMLRTFNSTLAPIFTQL 356

  Fly   400 RIIDITDNPLNCSCELTWFPKL 421
            ..:|:...||.|.|||.|..:|
  Fly   357 AELDLNGLPLQCDCELVWLKQL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 3/11 (27%)
LRR_RI 93..384 CDD:238064 78/343 (23%)
leucine-rich repeat 107..129 CDD:275380 4/44 (9%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
LRR_8 154..214 CDD:290566 11/59 (19%)
leucine-rich repeat 155..178 CDD:275380 4/22 (18%)
leucine-rich repeat 179..203 CDD:275380 2/23 (9%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRR_8 226..286 CDD:290566 20/60 (33%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 19/82 (23%)
leucine-rich repeat 276..300 CDD:275380 6/24 (25%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 6/24 (25%)
LRR_8 349..409 CDD:290566 18/94 (19%)
leucine-rich repeat 350..373 CDD:275380 7/26 (27%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 6/45 (13%)
LRR_8 108..167 CDD:290566 19/58 (33%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
LRR_RI <121..>261 CDD:238064 37/142 (26%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
leucine-rich repeat 157..180 CDD:275380 9/22 (41%)
leucine-rich repeat 181..208 CDD:275380 7/26 (27%)
leucine-rich repeat 230..253 CDD:275380 8/22 (36%)
leucine-rich repeat 254..274 CDD:275380 7/24 (29%)
leucine-rich repeat 275..299 CDD:275380 5/23 (22%)
leucine-rich repeat 300..319 CDD:275380 7/18 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.