DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Gp150

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_477049.2 Gene:Gp150 / 37549 FlyBaseID:FBgn0013272 Length:1076 Species:Drosophila melanogaster


Alignment Length:449 Identity:110/449 - (24%)
Similarity:181/449 - (40%) Gaps:97/449 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 GLDILCETTDLAHITKSMGTLKG-------------KSPIIFYLKLRHNNLPKLQGFVFLAL-DI 106
            ||.|:...|.:.:....|.|:.|             ||..|..|....|||.:|....|..| ::
  Fly   352 GLAIINPDTFVGNKKLRMLTISGNDLSVMSSIHYLLKSSSIEELDFSRNNLMELNPKAFSHLSNV 416

  Fly   107 RHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVP-------SQALQHLFH---------- 154
            .::.:..:||..:.|.|...:.. |.:||:|.|.:..:|       :.::.||.:          
  Fly   417 VYINLSQNSLKKLPEKAFEKVTL-LEELDLSYNSLTELPRDIFNGTTLSILHLKYNTFNGDLHFG 480

  Fly   155 ---LLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTN 216
               |..|:|:.|.|..:|::.|:.:..|..|.|..|.|.:|.|::|..|: :::.::|..|||..
  Fly   481 TKDLQQLDLSFNSIVQVHHSMFDKMPGLTNLNLKGNGIKKIQPDSFLTLK-NLRHIDLSINDLDQ 544

  Fly   217 I------PQKALSILS----------------------TLKKLEIQENKIRTISEGDFEGLQSLD 253
            |      ....|.::.                      |:..|:|....|..:....|..:..|.
  Fly   545 ISGMLFFKNSELDVIRLNDNPRLSQLPTDGFLSYSGEFTVYYLDISNCAIGPLGHKAFSTMPHLT 609

  Fly   254 SLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEA 318
            :|.||.|.|..:|..:|:.|..|..|:|..|.|:.:|...|....| |..|.|..|.|..:....
  Fly   610 TLKLAWNNINHLPREIFTGLHKLIDLDLSNNLITRMDDLIFMDNGE-LTKLSLAGNPISRLSVRL 673

  Fly   319 LRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNK 383
            ..|||:||.||:.:..:..|..|...|.|                    ::..:||.:.|...|.
  Fly   674 FLPLHQLRCLDVNDCELTTLLSDRDLGAG--------------------YKIFDSLRSFNASGNL 718

  Fly   384 LQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWF-----------PKLLEDLKNKDDE 431
            :::|..:.::. ...||.:|||:|||.|:.:...|           ||.|..|.|.:|:
  Fly   719 IKKISSEDVKS-FKNLRSLDITNNPLKCTPDFQEFISYVTLQMQMTPKRLPVLANLEDD 776

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 7/20 (35%)
LRR_RI 93..384 CDD:238064 80/339 (24%)
leucine-rich repeat 107..129 CDD:275380 4/21 (19%)
leucine-rich repeat 131..154 CDD:275380 8/29 (28%)
LRR_8 154..214 CDD:290566 18/72 (25%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 9/23 (39%)
leucine-rich repeat 204..227 CDD:275380 6/50 (12%)
LRR_8 226..286 CDD:290566 18/81 (22%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 20/58 (34%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 7/22 (32%)
leucine-rich repeat 325..349 CDD:275380 8/23 (35%)
LRR_8 349..409 CDD:290566 11/59 (19%)
leucine-rich repeat 350..373 CDD:275380 0/22 (0%)
Gp150NP_477049.2 LRR_8 317..377 CDD:290566 7/24 (29%)
leucine-rich repeat 343..366 CDD:275380 4/13 (31%)
leucine-rich repeat 367..391 CDD:275380 5/23 (22%)
LRR_RI <374..619 CDD:238064 55/246 (22%)
LRR_8 390..450 CDD:290566 17/60 (28%)
leucine-rich repeat 393..415 CDD:275380 7/21 (33%)
leucine-rich repeat 416..439 CDD:275380 4/22 (18%)
leucine-rich repeat 440..483 CDD:275380 8/42 (19%)
leucine-rich repeat 463..481 CDD:275380 2/17 (12%)
LRR_8 484..542 CDD:290566 18/58 (31%)
leucine-rich repeat 484..507 CDD:275380 7/22 (32%)
leucine-rich repeat 508..531 CDD:275380 9/23 (39%)
leucine-rich repeat 532..569 CDD:275380 6/36 (17%)
leucine-rich repeat 556..583 CDD:275380 1/26 (4%)
leucine-rich repeat 570..607 CDD:275380 5/36 (14%)
LRR_RI <586..745 CDD:238064 50/180 (28%)
LRR_8 606..666 CDD:290566 21/60 (35%)
leucine-rich repeat 608..631 CDD:275380 9/22 (41%)
leucine-rich repeat 632..655 CDD:275380 7/22 (32%)
leucine-rich repeat 656..674 CDD:275380 5/17 (29%)
leucine-rich repeat 733..745 CDD:275378 8/11 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.