DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and CG4168

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:440 Identity:122/440 - (27%)
Similarity:202/440 - (45%) Gaps:83/440 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ 150
            |.|..|.:.:|...||.|..|.||.:..::::.:..:|...|...|..||:..|::.||| .||.
  Fly   369 LNLEQNFVTQLPEAVFKATGIAHLVLAFNAISRVHPSAFEGLTETLEYLDLERNRLTTVP-VALS 432

  Fly   151 HLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDH--IKRLNLGGND 213
            .|.||..|.|..|:|:.: ||.....|.|.:|:|..|..:.|   ...||:::  :..||:|.|.
  Fly   433 SLHHLKYLYLTSNQISQL-NNLPSFTENLRVLSLSGNNFSMI---PVLGLKNYTQLSYLNMGYNS 493

  Fly   214 LTNIPQKALSI---LSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLT- 274
            :|:||:...::   .|.|:.:.::.|||..:..|.|.||:.:..:.|:.|.||.....||.::: 
  Fly   494 ITDIPEGIFAVDSWGSNLQTILLRNNKITHLHLGSFAGLEQIQEISLSFNDITIHHPLVFENVSR 558

  Fly   275 LLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLA 339
            .|..|||   ..:|....:.:.|:                |.:||.||.:|..|.|.|||:..::
  Fly   559 TLKILEL---SFAVFPARSLESLD----------------PLDALLPLSQLIWLGLDNNNLKQVS 604

  Fly   340 EDAFTGFGDSLTFLNLQKNDIKVLPSLLFE--------------------------NLNSLETLN 378
            .::|....: |:::||..|.:|.||..||:                          :|..|:|||
  Fly   605 NESFAQMRE-LSYINLSFNQLKTLPRGLFQSDAHSHLVEIDLSYNGLERLEAQTFHSLGDLQTLN 668

  Fly   379 LQNNKLQRIPQDIMEPVIDTLRIIDITDNPL-NCS-CELTWFPKL--LEDLKNKDDEMSQKKKPL 439
            ||:|:|:.|.:..... ::.||.:|::.|.| |.| ...|..|.|  |:.:.|:          |
  Fly   669 LQSNRLRTIARHAFHN-LEFLRYLDLSYNRLVNISHGAFTVLPNLAALDLMHNQ----------L 722

  Fly   440 CHMSLDNREYFVQAMPTEKMHCAGLNVSPSPTS------GGLMRILQVNI 483
            |.:||  :.:...:..|..:.   ||||.:..:      ...|.|.|::|
  Fly   723 CSLSL--KSFLYVSNTTTPLR---LNVSHNHIASFYDELSSYMYIYQLDI 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 7/18 (39%)
LRR_RI 93..384 CDD:238064 92/322 (29%)
leucine-rich repeat 107..129 CDD:275380 4/21 (19%)
leucine-rich repeat 131..154 CDD:275380 10/22 (45%)
LRR_8 154..214 CDD:290566 20/61 (33%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 7/23 (30%)
leucine-rich repeat 204..227 CDD:275380 7/25 (28%)
LRR_8 226..286 CDD:290566 19/60 (32%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 6/23 (26%)
LRR_8 276..335 CDD:290566 16/58 (28%)
leucine-rich repeat 276..300 CDD:275380 6/23 (26%)
leucine-rich repeat 301..324 CDD:275380 5/22 (23%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 23/85 (27%)
leucine-rich repeat 350..373 CDD:275380 10/48 (21%)
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064 56/181 (31%)
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566 16/54 (30%)
leucine-rich repeat 366..388 CDD:275380 7/18 (39%)
leucine-rich repeat 389..412 CDD:275380 5/22 (23%)
LRR_8 413..470 CDD:290566 23/58 (40%)
leucine-rich repeat 414..436 CDD:275380 10/22 (45%)
leucine-rich repeat 437..459 CDD:275380 7/22 (32%)
leucine-rich repeat 460..483 CDD:275380 7/25 (28%)
LRR_8 482..545 CDD:290566 18/62 (29%)
leucine-rich repeat 484..510 CDD:275380 7/25 (28%)
leucine-rich repeat 511..534 CDD:275380 8/22 (36%)
leucine-rich repeat 535..589 CDD:275380 17/72 (24%)
LRR_RI 588..891 CDD:238064 51/197 (26%)
LRR_8 588..650 CDD:290566 16/62 (26%)
leucine-rich repeat 590..613 CDD:275380 7/22 (32%)
leucine-rich repeat 614..639 CDD:275380 9/24 (38%)
LRR_8 638..698 CDD:290566 14/60 (23%)
leucine-rich repeat 640..663 CDD:275380 1/22 (5%)
leucine-rich repeat 664..687 CDD:275380 9/23 (39%)
LRR_8 688..749 CDD:290566 21/75 (28%)
leucine-rich repeat 688..711 CDD:275380 8/22 (36%)
leucine-rich repeat 712..735 CDD:275380 7/34 (21%)
leucine-rich repeat 740..783 CDD:275380 8/31 (26%)
LRR_8 784..843 CDD:290566
leucine-rich repeat 785..808 CDD:275380
leucine-rich repeat 809..832 CDD:275380
LRR_RI <827..1053 CDD:238064
LRR_8 832..890 CDD:290566
leucine-rich repeat 833..856 CDD:275380
leucine-rich repeat 857..879 CDD:275380
leucine-rich repeat 880..900 CDD:275380
LRR_8 904..963 CDD:290566
leucine-rich repeat 905..928 CDD:275380
leucine-rich repeat 929..952 CDD:275380
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
LRR_8 1019..1074 CDD:290566
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.