DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and kek1

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001303320.1 Gene:kek1 / 34688 FlyBaseID:FBgn0015399 Length:880 Species:Drosophila melanogaster


Alignment Length:214 Identity:68/214 - (31%)
Similarity:99/214 - (46%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 LTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNS 278
            |..||:   .|....:.|::..||::|:|...|                  :.||:.:    |..
  Fly   112 LIQIPE---HIDPNTQVLDMSGNKLQTLSNEQF------------------IRANLLN----LQK 151

  Fly   279 LELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAF 343
            |.|...||..|:::.|||| .||..|.|..|.:.|:||.||..:..||.|.|.:|:|:.:...||
  Fly   152 LYLRNCKIGEIERETFKGL-TNLVELDLSHNLLVTVPSLALGHIPSLRELTLASNHIHKIESQAF 215

  Fly   344 TGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTL-RI--IDIT 405
             |...||..|:|...||:.:.:..|..|..|..|.|..|||    .:::...|:|| |:  |::.
  Fly   216 -GNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKL----SELLPKTIETLSRLHGIELH 275

  Fly   406 DNPLNCSCEL----TWFPK 420
            |||..|.|.|    .|..|
  Fly   276 DNPWLCDCRLRDTKLWLMK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 53/169 (31%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566 68/214 (32%)
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380 4/12 (33%)
LRR_8 226..286 CDD:290566 11/59 (19%)
leucine-rich repeat 228..251 CDD:275380 6/22 (27%)
leucine-rich repeat 252..275 CDD:275380 2/22 (9%)
LRR_8 276..335 CDD:290566 25/58 (43%)
leucine-rich repeat 276..300 CDD:275380 10/23 (43%)
leucine-rich repeat 301..324 CDD:275380 9/22 (41%)
leucine-rich repeat 325..349 CDD:275380 9/23 (39%)
LRR_8 349..409 CDD:290566 21/62 (34%)
leucine-rich repeat 350..373 CDD:275380 7/22 (32%)
kek1NP_001303320.1 leucine-rich repeat 103..122 CDD:275380 4/12 (33%)
LRR_RI <119..277 CDD:238064 57/185 (31%)
leucine-rich repeat 123..148 CDD:275380 8/42 (19%)
LRR_8 148..207 CDD:290566 25/63 (40%)
leucine-rich repeat 149..172 CDD:275380 10/23 (43%)
leucine-rich repeat 173..196 CDD:275380 9/22 (41%)
LRR_8 195..255 CDD:290566 21/60 (35%)
leucine-rich repeat 197..220 CDD:275380 9/23 (39%)
leucine-rich repeat 221..244 CDD:275380 7/22 (32%)
leucine-rich repeat 245..268 CDD:275380 9/26 (35%)
LRRCT 277..327 CDD:214507 7/18 (39%)
IG_like 338..429 CDD:214653
Ig 346..426 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.