DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and CG42346

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:480 Identity:122/480 - (25%)
Similarity:196/480 - (40%) Gaps:109/480 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQ 150
            |...:|.:.::..:.|..|.|..|.:..:.|..:.|:|.:.|...:.::|||.|.::|.|..||:
  Fly   354 LDFDYNEIVRVDDYSFYGLRISKLNMKGNRLQGMPEHAFAGLEECMQEIDVSENGLRTFPLMALR 418

  Fly   151 HLFHLLILNLNHNKITVIH-------NNA--------------------------------FEGL 176
            .|.||.||.|::|:|...:       |||                                |...
  Fly   419 KLDHLRILRLSNNRIPTFYGDIQLATNNASAAAAAVGAFQLPSLIFLDLSSNQFAEIGPDCFRAF 483

  Fly   177 ETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTI 241
            ..|:.|:.|.|:|..:.||||:.|.: :..|::..|.:..:..|.......|:.:::..|.|.||
  Fly   484 PQLKTLSFYANQIELVQPEAFKSLRE-LMSLDMSHNRIIGLDPKVFEKNKRLQTVDLSHNHIHTI 547

  Fly   242 SEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQ--YL 304
            . |.|..|..|..:.|:.|.|..:||:.|::.|.::.:.||.|.|:.||.:.|..| .||.  ||
  Fly   548 G-GVFSNLPQLREVFLSENNILELPADAFTNSTNVDVIYLESNAIAHIDPNVFSTL-VNLDHLYL 610

  Fly   305 R----------------------LGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFG 347
            |                      |.:|:|..:.....|.|..||.:.|.||.|..:....|... 
  Fly   611 RSNFIPLLPVTLFDKSTKLTSLSLDNNEIQDLEIGMFRKLEHLREVRLHNNRIRRVRRGVFEPL- 674

  Fly   348 DSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTL------------- 399
            .||..|::|||.|:.:....|..|.:::.:|||:|:| .:.:||......:|             
  Fly   675 PSLQELHIQKNSIEDIEPQAFHTLENMQHINLQDNQL-TVLEDIFPDENSSLLSVQLEANYLHKV 738

  Fly   400 -----------RIIDITDNPLNCSCELTWF---PKL----LEDLKNKDDEMSQKKKPLCHMSLD- 445
                       :|:.:.||.|. ..|.::|   |:|    |.|.|.:|.|.......|....|| 
  Fly   739 HPRTFSRQQKVQIMWLKDNQLT-RVERSFFADTPQLGRLYLSDNKIRDIEKDTFVNLLLLQFLDL 802

  Fly   446 --------NREYFVQAMPTEKMHCA 462
                    .|:||......|::..|
  Fly   803 SGNQLRQLRRDYFAPLQDLEELSLA 827

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 3/18 (17%)
LRR_RI 93..384 CDD:238064 95/353 (27%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
leucine-rich repeat 131..154 CDD:275380 9/22 (41%)
LRR_8 154..214 CDD:290566 23/98 (23%)
leucine-rich repeat 155..178 CDD:275380 10/61 (16%)
leucine-rich repeat 179..203 CDD:275380 10/23 (43%)
leucine-rich repeat 204..227 CDD:275380 3/22 (14%)
LRR_8 226..286 CDD:290566 19/59 (32%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 23/82 (28%)
leucine-rich repeat 276..300 CDD:275380 8/23 (35%)
leucine-rich repeat 301..324 CDD:275380 9/46 (20%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
LRR_8 349..409 CDD:290566 20/83 (24%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566 6/29 (21%)
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380 29/106 (27%)
LRR_8 373..433 CDD:290566 21/59 (36%)
LRR_RI 397..648 CDD:238064 65/253 (26%)
leucine-rich repeat 399..422 CDD:275380 9/22 (41%)
leucine-rich repeat 462..485 CDD:275380 1/22 (5%)
LRR_8 465..520 CDD:290566 13/55 (24%)
leucine-rich repeat 486..509 CDD:275380 10/22 (45%)
LRR_8 508..567 CDD:290566 14/60 (23%)
leucine-rich repeat 510..533 CDD:275380 3/22 (14%)
LRR_RI 527..785 CDD:238064 69/262 (26%)
leucine-rich repeat 534..556 CDD:275380 8/22 (36%)
LRR_8 555..613 CDD:290566 21/58 (36%)
leucine-rich repeat 557..580 CDD:275380 7/22 (32%)
leucine-rich repeat 581..604 CDD:275380 8/23 (35%)
LRR_8 604..663 CDD:290566 15/58 (26%)
leucine-rich repeat 605..628 CDD:275380 4/22 (18%)
leucine-rich repeat 629..652 CDD:275380 5/22 (23%)
LRR_8 652..711 CDD:290566 20/59 (34%)
leucine-rich repeat 653..676 CDD:275380 7/23 (30%)
leucine-rich repeat 677..700 CDD:275380 8/22 (36%)
leucine-rich repeat 701..748 CDD:275380 8/47 (17%)
leucine-rich repeat 725..736 CDD:275378 1/10 (10%)
leucine-rich repeat 749..772 CDD:275380 6/23 (26%)
LRR_8 771..831 CDD:290566 15/57 (26%)
leucine-rich repeat 773..793 CDD:275380 6/19 (32%)
LRR_RI 804..1076 CDD:238064 5/24 (21%)
LRR_8 821..903 CDD:290566 2/7 (29%)
leucine-rich repeat 821..844 CDD:275380 2/7 (29%)
leucine-rich repeat 845..868 CDD:275380
leucine-rich repeat 869..892 CDD:275380
leucine-rich repeat 893..915 CDD:275380
leucine-rich repeat 916..944 CDD:275380
leucine-rich repeat 945..968 CDD:275380
LRR_8 967..1027 CDD:290566
leucine-rich repeat 969..992 CDD:275380
leucine-rich repeat 993..1014 CDD:275380
LRR_8 1015..1075 CDD:290566
leucine-rich repeat 1017..1040 CDD:275380
leucine-rich repeat 1041..1064 CDD:275380
LRR_RI <1047..1244 CDD:238064
LRR_8 1063..1125 CDD:290566
leucine-rich repeat 1089..1114 CDD:275380
leucine-rich repeat 1115..1162 CDD:275380
LRR_8 1163..1219 CDD:290566
leucine-rich repeat 1163..1186 CDD:275380
leucine-rich repeat 1187..1210 CDD:275380
leucine-rich repeat 1211..1233 CDD:275380
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.