Sequence 1: | NP_001246198.1 | Gene: | CG14762 / 35768 | FlyBaseID: | FBgn0033250 | Length: | 498 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034788.1 | Gene: | Lrfn2 / 316205 | RGDID: | 1311831 | Length: | 788 | Species: | Rattus norvegicus |
Alignment Length: | 299 | Identity: | 78/299 - (26%) |
---|---|---|---|
Similarity: | 125/299 - (41%) | Gaps: | 72/299 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 LNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFS 271
Fly 272 HLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNIN 336
Fly 337 VLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRI 401
Fly 402 IDIT-------------DNPLNCSCELTWFPKLLEDLKNKDDEMSQ-------KKKPLCHMSLDN 446
Fly 447 REYFVQAMP--TEKMH-------------CAGLNVSPSP 470 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14762 | NP_001246198.1 | leucine-rich repeat | 85..105 | CDD:275380 | |
LRR_RI | 93..384 | CDD:238064 | 49/176 (28%) | ||
leucine-rich repeat | 107..129 | CDD:275380 | |||
leucine-rich repeat | 131..154 | CDD:275380 | |||
LRR_8 | 154..214 | CDD:290566 | 5/6 (83%) | ||
leucine-rich repeat | 155..178 | CDD:275380 | |||
leucine-rich repeat | 179..203 | CDD:275380 | |||
leucine-rich repeat | 204..227 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 226..286 | CDD:290566 | 17/59 (29%) | ||
leucine-rich repeat | 228..251 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 252..275 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 276..335 | CDD:290566 | 18/58 (31%) | ||
leucine-rich repeat | 276..300 | CDD:275380 | 7/23 (30%) | ||
leucine-rich repeat | 301..324 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 325..349 | CDD:275380 | 6/23 (26%) | ||
LRR_8 | 349..409 | CDD:290566 | 16/72 (22%) | ||
leucine-rich repeat | 350..373 | CDD:275380 | 5/22 (23%) | ||
Lrfn2 | NP_001034788.1 | LRR_RI | 27..>209 | CDD:238064 | 49/176 (28%) |
LRR 1 | 53..74 | 6/16 (38%) | |||
leucine-rich repeat | 54..77 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 76..136 | CDD:290566 | 17/59 (29%) | ||
LRR 2 | 77..98 | 6/20 (30%) | |||
leucine-rich repeat | 78..101 | CDD:275380 | 7/22 (32%) | ||
LRR 3 | 101..122 | 6/20 (30%) | |||
leucine-rich repeat | 102..125 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 125..185 | CDD:290566 | 18/59 (31%) | ||
LRR 4 | 125..146 | 7/20 (35%) | |||
leucine-rich repeat | 126..150 | CDD:275380 | 7/23 (30%) | ||
LRR 5 | 150..171 | 6/20 (30%) | |||
leucine-rich repeat | 151..174 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 174..>215 | CDD:290566 | 18/65 (28%) | ||
LRR 6 | 174..195 | 8/29 (28%) | |||
leucine-rich repeat | 175..198 | CDD:275380 | 9/31 (29%) | ||
LRR 7 | 198..219 | 10/39 (26%) | |||
LRRCT | 242..286 | CDD:214507 | 15/51 (29%) | ||
IG_like | 298..376 | CDD:214653 | 4/22 (18%) | ||
Ig | 303..376 | CDD:299845 | 4/17 (24%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..423 | ||||
fn3 | 428..493 | CDD:278470 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 620..655 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 668..707 | ||||
PDZ-binding | 785..788 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |