DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrfn5

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001101494.1 Gene:Lrfn5 / 314164 RGDID:1309357 Length:719 Species:Rattus norvegicus


Alignment Length:242 Identity:76/242 - (31%)
Similarity:120/242 - (49%) Gaps:22/242 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.:..|...||..:.||..|.|:.|.|:.:..:.|:.|..|.:|.|..|:::.|..|.|
  Rat    55 ELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMF 119

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKND 359
            .|| .||.:|.|.:||:..|.|.|...:..|..|||..||:..:..||.... .||..|:|..|.
  Rat   120 SGL-SNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKM-VSLHTLSLDHNM 182

  Fly   360 IKVLPSLLFENLNSLETLNLQNNKLQRIPQDIM---EPVIDTLRII-------DITDNPLNCSCE 414
            |..:|...|.:|:.:..|::.:||||::|.|.:   ..|:.|..||       ....|||:|:||
  Rat   183 IDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCE 247

  Fly   415 LTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |.|..:|     :::|::.....|    :|....|| .::|.|:..|
  Rat   248 LLWLRRL-----SREDDLETCASP----ALLTGRYF-WSIPEEEFLC 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 50/153 (33%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
LRR_8 226..286 CDD:290566 17/55 (31%)
leucine-rich repeat 228..251 CDD:275380 5/20 (25%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 23/58 (40%)
leucine-rich repeat 276..300 CDD:275380 9/23 (39%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 8/23 (35%)
LRR_8 349..409 CDD:290566 21/69 (30%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
Lrfn5NP_001101494.1 LRR 1 52..73 5/17 (29%)
leucine-rich repeat 53..76 CDD:275380 5/20 (25%)
PPP1R42 56..211 CDD:411060 53/156 (34%)
LRR 2 76..97 7/20 (35%)
leucine-rich repeat 77..100 CDD:275380 7/22 (32%)
LRR 3 100..121 7/20 (35%)
leucine-rich repeat 101..124 CDD:275380 9/23 (39%)
LRR 4 124..145 9/20 (45%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR 5 148..169 8/20 (40%)
leucine-rich repeat 149..172 CDD:275380 8/23 (35%)
LRR 6 172..193 8/20 (40%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR 7 196..217 7/20 (35%)
leucine-rich repeat 197..215 CDD:275380 7/17 (41%)
TPKR_C2 240..>272 CDD:417692 12/40 (30%)
IgI_SALM5_like 287..374 CDD:409421
Ig strand B 304..308 CDD:409421
Ig strand C 317..321 CDD:409421
Ig strand E 340..344 CDD:409421
Ig strand F 354..359 CDD:409421
Ig strand G 367..370 CDD:409421
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..416
FN3 421..494 CDD:419708
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 614..719
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.