DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrrc55

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001381943.1 Gene:Lrrc55 / 311171 RGDID:1561726 Length:311 Species:Rattus norvegicus


Alignment Length:220 Identity:54/220 - (24%)
Similarity:89/220 - (40%) Gaps:54/220 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEA 318
            :|.||||.|..||....:....|..|:|..|.:..:....|.. .:.|.:|.|..|.:..:|::.
  Rat    82 NLSLAHNRIAAVPPGYLTCYMELRVLDLRNNSLMELPPGLFLH-AKRLAHLDLSYNNLSHVPADM 145

  Fly   319 LRPLHRLRHLDLRNNN-INVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNN 382
            .|..|.|.|:||.:|. :..:...||.|      .::|:..|:. ...|.|.:|.:||.|     
  Rat   146 FREAHGLVHIDLSHNPWLRRVHPQAFQG------LVHLRDLDLS-YGGLAFLSLEALEGL----- 198

  Fly   383 KLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPKLLEDLKNK------DDEMSQKKKP--- 438
                       |.:.||:   |..||..|.|.:   ..||:.|:|:      |.::::.:.|   
  Rat   199 -----------PGLVTLQ---IGGNPWVCGCTM---EPLLKWLRNRIQRCTADSQLAECRGPPEV 246

  Fly   439 --------------LCHMSLDNREY 449
                          .||::|...:|
  Rat   247 EGAPLFSLTEESFKACHLTLTLDDY 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
leucine-rich repeat 107..129 CDD:275380
LRR <131..410 CDD:443914 42/156 (27%)
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
leucine-rich repeat 228..251 CDD:275380
leucine-rich repeat 252..275 CDD:275380 8/20 (40%)
leucine-rich repeat 276..300 CDD:275380 5/23 (22%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..349 CDD:275380 8/24 (33%)
leucine-rich repeat 350..373 CDD:275380 5/22 (23%)
Lrrc55NP_001381943.1 LRR <60..>237 CDD:443914 49/184 (27%)
leucine-rich repeat 60..79 CDD:275380
leucine-rich repeat 80..103 CDD:275380 8/20 (40%)
leucine-rich repeat 104..127 CDD:275380 5/23 (22%)
leucine-rich repeat 128..151 CDD:275380 6/22 (27%)
leucine-rich repeat 152..176 CDD:275380 8/29 (28%)
leucine-rich repeat 177..200 CDD:275380 8/39 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.