DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrfn3

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001100972.1 Gene:Lrfn3 / 308495 RGDID:1305567 Length:626 Species:Rattus norvegicus


Alignment Length:246 Identity:69/246 - (28%)
Similarity:116/246 - (47%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.|..:...|...:..|..|.|:.|.|..|.|..|:.|..|.:|.|:||:::.:.:...
  Rat    63 ELRLADNFIAAVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLTSLGEGQL 127

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
            :|| .||::|.|.:||:..:.:.||.. ...|..|||..||:..|..:|....|:..| |.|..|
  Rat   128 RGL-VNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLGNVNT-LGLDHN 190

  Fly   359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTL-------------RIIDITDNPLN 410
            .:..:|:..|..|:.|..|::.:|:|..||.|   |:...|             .::....|||:
  Rat   191 LLASVPAGAFSRLHKLARLDMTSNRLTTIPPD---PLFSRLPLLARPRGSPASALVLAFGGNPLH 252

  Fly   411 CSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |:|||.|..:|.     ::|::.....|   .:|..|.::  |:..|:..|
  Rat   253 CNCELVWLRRLA-----REDDLEACASP---PALGGRYFW--AVGEEEFVC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
leucine-rich repeat 107..129 CDD:275380
LRR <131..410 CDD:443914 55/193 (28%)
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
leucine-rich repeat 228..251 CDD:275380 4/20 (20%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
leucine-rich repeat 325..349 CDD:275380 9/23 (39%)
leucine-rich repeat 350..373 CDD:275380 7/22 (32%)
Lrfn3NP_001100972.1 leucine-rich repeat 63..84 CDD:275380 4/20 (20%)
LRR <78..>228 CDD:443914 49/154 (32%)
LRR 1 84..105 8/20 (40%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
LRR 2 108..129 5/20 (25%)
leucine-rich repeat 109..132 CDD:275380 7/23 (30%)
LRR 3 132..153 8/20 (40%)
leucine-rich repeat 133..157 CDD:275380 7/23 (30%)
LRR 4 157..178 8/20 (40%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
LRR 5 181..202 6/21 (29%)
leucine-rich repeat 182..205 CDD:275380 7/23 (30%)
LRR 6 205..226 8/23 (35%)
leucine-rich repeat 206..230 CDD:275380 9/26 (35%)
leucine-rich repeat 242..253 CDD:275378 3/10 (30%)
LRRCT 249..>281 CDD:214507 12/39 (31%)
Ig 296..383 CDD:472250
Ig strand B 313..317 CDD:409353
Ig strand C 326..330 CDD:409353
Ig strand E 349..353 CDD:409353
Ig strand F 363..368 CDD:409353
Ig strand G 376..379 CDD:409353
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..423
fn3 425..502 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.