DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrfn3

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_780687.1 Gene:Lrfn3 / 233067 MGIID:2442512 Length:626 Species:Mus musculus


Alignment Length:246 Identity:69/246 - (28%)
Similarity:116/246 - (47%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.|..:...|...:..|..|.|:.|.|..|.|..|:.|..|.:|.|:||:::.:.:...
Mouse    63 ELRLADNFIAAVRRRDLANMTGLLHLSLSRNTIRHVAAGAFADLRALRALHLDGNRLTSLGEGQL 127

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
            :|| .||::|.|.:||:..:.:.||.. ...|..|||..||:..|..:|....|:..| |.|..|
Mouse   128 RGL-VNLRHLILSNNQLAALAAGALDDCAETLEDLDLSYNNLEQLPWEALGRLGNVNT-LGLDHN 190

  Fly   359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTL-------------RIIDITDNPLN 410
            .:..:|:..|..|:.|..|::.:|:|..||.|   |:...|             .::....|||:
Mouse   191 LLASVPAGAFSRLHKLARLDMTSNRLTTIPPD---PLFSRLPLLARPRGSPASALVLAFGGNPLH 252

  Fly   411 CSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |:|||.|..:|.     ::|::.....|   .:|..|.::  |:..|:..|
Mouse   253 CNCELVWLRRLA-----REDDLEACASP---PALGGRYFW--AVGEEEFVC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 47/154 (31%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
LRR_8 226..286 CDD:290566 18/55 (33%)
leucine-rich repeat 228..251 CDD:275380 4/20 (20%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 20/59 (34%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 7/23 (30%)
leucine-rich repeat 325..349 CDD:275380 9/23 (39%)
LRR_8 349..409 CDD:290566 17/72 (24%)
leucine-rich repeat 350..373 CDD:275380 7/22 (32%)
Lrfn3NP_780687.1 LRR <63..>222 CDD:227223 50/160 (31%)
leucine-rich repeat 63..84 CDD:275380 4/20 (20%)
LRR 1 84..105 8/20 (40%)
leucine-rich repeat 85..108 CDD:275380 9/22 (41%)
LRR 2 108..129 5/20 (25%)
leucine-rich repeat 109..132 CDD:275380 7/23 (30%)
LRR 3 132..153 8/20 (40%)
leucine-rich repeat 133..157 CDD:275380 7/23 (30%)
LRR 4 157..178 8/20 (40%)
leucine-rich repeat 158..181 CDD:275380 8/22 (36%)
LRR 5 181..202 6/21 (29%)
leucine-rich repeat 182..205 CDD:275380 7/23 (30%)
LRR 6 205..226 8/23 (35%)
leucine-rich repeat 206..230 CDD:275380 9/26 (35%)
leucine-rich repeat 242..253 CDD:275378 3/10 (30%)
TPKR_C2 249..>281 CDD:326558 12/39 (31%)
Ig 310..383 CDD:325142
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 382..425
fn3 425..502 CDD:306538
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 590..626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.