DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and Lrfn4

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_700437.2 Gene:Lrfn4 / 225875 MGIID:2385612 Length:636 Species:Mus musculus


Alignment Length:244 Identity:73/244 - (29%)
Similarity:114/244 - (46%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.|:.:...||..:..|..|.|:.|.||.:.|..|..|..|.||.|:||::..:...:.
Mouse    52 ELRLADNFIQALGPPDFRNMTGLVDLTLSRNAITRIGARSFGDLESLRSLHLDGNRLVELGSSSL 116

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRP-LHRLRHLDLRNNNINVLAEDAFTGFGD--SLTFLNLQ 356
            :| ..|||:|.|..||:..|...|... |..|..||:..||   |.:..:.|.|.  :|..|||.
Mouse   117 RG-PVNLQHLILSGNQLGRIAPGAFDDFLDSLEDLDVSYNN---LRQVPWAGIGSMPALHTLNLD 177

  Fly   357 KNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLR---------IIDITDNPLNCS 412
            .|.|..||..:|..|:.|..|:|.:|:|..:..|   |:....|         ::..:.|||:|:
Mouse   178 HNLIDALPPGVFAQLSQLSRLDLTSNRLATLAPD---PLFSRGRDAEASPSPLVLSFSGNPLHCN 239

  Fly   413 CELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |||.|..:|.     :.|::.....|   .:|..|.::  |:|..:..|
Mouse   240 CELLWLRRLA-----RPDDLETCASP---PTLAGRYFW--AVPEGEFSC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
leucine-rich repeat 107..129 CDD:275380
LRR <131..410 CDD:443914 59/191 (31%)
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
leucine-rich repeat 228..251 CDD:275380 5/20 (25%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..349 CDD:275380 8/25 (32%)
leucine-rich repeat 350..373 CDD:275380 10/22 (45%)
Lrfn4NP_700437.2 LRR 1 49..70 5/17 (29%)
leucine-rich repeat 50..73 CDD:275380 5/20 (25%)
LRR <52..>210 CDD:443914 54/161 (34%)
LRR 2 73..94 8/20 (40%)
leucine-rich repeat 74..97 CDD:275380 9/22 (41%)
LRR 3 97..118 6/20 (30%)
leucine-rich repeat 98..121 CDD:275380 7/23 (30%)
LRR 4 121..142 9/20 (45%)
leucine-rich repeat 122..146 CDD:275380 9/23 (39%)
LRR 5 146..169 8/25 (32%)
leucine-rich repeat 147..170 CDD:275380 8/25 (32%)
LRR 6 170..191 9/20 (45%)
leucine-rich repeat 171..194 CDD:275380 10/22 (45%)
LRR 7 194..215 7/23 (30%)
leucine-rich repeat 195..213 CDD:275380 6/20 (30%)
LRRCT 234..278 CDD:214507 15/53 (28%)
Ig 281..368 CDD:472250
Ig strand B 298..302 CDD:409353
Ig strand C 311..315 CDD:409353
Ig strand E 334..338 CDD:409353
Ig strand F 348..353 CDD:409353
Ig strand G 361..364 CDD:409353
fn3 409..478 CDD:394996
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 556..585
PDZ-binding 633..636
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.