DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and iglr-3

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001293349.1 Gene:iglr-3 / 171771 WormBaseID:WBGene00021353 Length:488 Species:Caenorhabditis elegans


Alignment Length:352 Identity:88/352 - (25%)
Similarity:137/352 - (38%) Gaps:83/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 LTLYENKITQID--PEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEG 244
            |:|..|.|.:|.  |..:|.|:.    |.|....|..:...|||:...|::|::..|.:..:...
 Worm    54 LSLSNNSIFRITTFPSEYRRLQS----LRLDQCQLEKLDFDALSVFEQLRELDVSRNSLSKLIIP 114

  Fly   245 DFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDN 309
              ..|.||..|.||.|..|.||.  .|||..|..::|..|::..:..   :.|..||:.:||..|
 Worm   115 --RNLASLRVLNLAFNAFTYVPD--MSHLESLRLVDLSHNRLISVRP---RMLPFNLEVVRLAAN 172

  Fly   310 QIHTIPSEALRP---LHRLRHLDLRNNNINVLAEDA----FTGFGDSLTFLNLQKNDIKVLPSLL 367
            :.     :.|.|   ||:|:.||:..|::..   |.    |..:.:.|...     |..:||.  
 Worm   173 RF-----QHLSPWPFLHKLQELDVTFNDLEC---DCSLWHFVTWAEKLALF-----DSTMLPC-- 222

  Fly   368 FENLNSLETLNLQNNKLQRIPQD---IMEPVIDT----LRIIDITDNPLNCSCEL-TWFPKLLED 424
                       .:.::|::.|.|   :..|.:.|    ..::.:.|..:.|...| |..|:|...
 Worm   223 -----------RRPSELRKSPIDGKTVCGPTVVTSSPESAVVSLDDAHVMCCTALATPSPQLYWQ 276

  Fly   425 L--KNKDDEMSQKKKPLCHMSLDNREYFVQAMP------TEKMHC----AGLNVSPS-------- 469
            .  ||....:|||     |:|...:..|...:|      ..|..|    ||||.|..        
 Worm   277 FNGKNISSGLSQK-----HLSESGKLEFCLEIPKVRLKDMGKYKCVASLAGLNSSKEFHVERDKI 336

  Fly   470 ----PTSGGLMRILQVNILAQIAVCSV 492
                .::.|:|...|..|...|.||.|
 Worm   337 PIVLNSAEGIMIYCQFTICTFIGVCCV 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 53/210 (25%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566 10/33 (30%)
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380 8/22 (36%)
leucine-rich repeat 204..227 CDD:275380 6/22 (27%)
LRR_8 226..286 CDD:290566 19/59 (32%)
leucine-rich repeat 228..251 CDD:275380 4/22 (18%)
leucine-rich repeat 252..275 CDD:275380 11/22 (50%)
LRR_8 276..335 CDD:290566 17/61 (28%)
leucine-rich repeat 276..300 CDD:275380 4/23 (17%)
leucine-rich repeat 301..324 CDD:275380 7/25 (28%)
leucine-rich repeat 325..349 CDD:275380 6/27 (22%)
LRR_8 349..409 CDD:290566 10/66 (15%)
leucine-rich repeat 350..373 CDD:275380 4/22 (18%)
iglr-3NP_001293349.1 LRR <47..>196 CDD:227223 47/157 (30%)
leucine-rich repeat 51..73 CDD:275380 6/18 (33%)
leucine-rich repeat 74..97 CDD:275380 7/26 (27%)
leucine-rich repeat 98..119 CDD:275380 4/22 (18%)
leucine-rich repeat 120..141 CDD:275380 11/22 (50%)
leucine-rich repeat 142..163 CDD:275380 4/23 (17%)
leucine-rich repeat 164..185 CDD:275380 7/25 (28%)
Ig_3 243..319 CDD:372822 18/80 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.