DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and LINGO2

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_689783.1 Gene:LINGO2 / 158038 HGNCID:21207 Length:606 Species:Homo sapiens


Alignment Length:485 Identity:112/485 - (23%)
Similarity:195/485 - (40%) Gaps:91/485 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCICTVKKNGLDILCETTDLAHITKSMGTLKGKSPI 82
            |.:.::.|...:|        ||     |.|.|:.:..  .:.|....|..|.:.:       ||
Human    15 LAVVLIFMGSTIG--------CP-----ARCECSAQNK--SVSCHRRRLIAIPEGI-------PI 57

  Fly    83 -IFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPS 146
             ...|.|..|.|..:....|::..:                        |.::|:|.|.:..|..
Human    58 ETKILDLSKNRLKSVNPEEFISYPL------------------------LEEIDLSDNIIANVEP 98

  Fly   147 QALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGG 211
            .|..:||:|..|.|..|::.::....|.||..|..|.:.||||..:....|:.|. ::|.|.:|.
Human    99 GAFNNLFNLRSLRLKGNRLKLVPLGVFTGLSNLTKLDISENKIVILLDYMFQDLH-NLKSLEVGD 162

  Fly   212 NDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLL 276
            |||..|..:|.|.|.:|::|.:::..:..:.......|:||.||.|.|..|..:|...|..|..|
Human   163 NDLVYISHRAFSGLLSLEQLTLEKCNLTAVPTEALSHLRSLISLHLKHLNINNMPVYAFKRLFHL 227

  Fly   277 NSLELE-GNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAE 340
            ..||:: ...:.::..::..||  ||..|.:.:..:.|:|..|.:.|..|.||:|..|.|:.:..
Human   228 KHLEIDYWPLLDMMPANSLYGL--NLTSLSVTNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEA 290

  Fly   341 DAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDIT 405
            ..|:.. ..|..|::....::.:....|:.|..|..||:..|.|:.:.:::.... ..|.::.|.
Human   291 GMFSDL-IRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSP-RALEVLSIN 353

  Fly   406 DNPLNCSCELTWF------------------PKLLEDLKNKDDEMSQ------------KKKPLC 440
            :|||.|.|.|.|.                  |..:.:...||...:.            ::|.|.
Human   354 NNPLACDCRLLWILQRQPTLQFGGQQPMCAGPDTIRERSFKDFHSTALSFYFTCKKPKIREKKLQ 418

  Fly   441 HMSLDNREYFVQAMPTEKMHCAGLNVSPSP 470
            |:.:|..:       |.::.|:. :..|.|
Human   419 HLLVDEGQ-------TVQLECSA-DGDPQP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 5/19 (26%)
leucine-rich repeat 107..129 CDD:275380 0/21 (0%)
LRR <131..410 CDD:443914 78/279 (28%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 8/23 (35%)
leucine-rich repeat 204..227 CDD:275380 10/22 (45%)
leucine-rich repeat 228..251 CDD:275380 3/22 (14%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
leucine-rich repeat 276..300 CDD:275380 5/24 (21%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 4/22 (18%)
LINGO2NP_689783.1 LRRNT 27..60 CDD:214470 11/54 (20%)
leucine-rich repeat 39..57 CDD:275380 3/26 (12%)
LRR 48..>340 CDD:443914 83/326 (25%)
LRR 1 58..79 5/20 (25%)
leucine-rich repeat 59..82 CDD:275380 5/22 (23%)
LRR 2 82..103 6/44 (14%)
leucine-rich repeat 83..106 CDD:275380 7/22 (32%)
LRR 3 106..127 5/20 (25%)
leucine-rich repeat 107..130 CDD:275380 7/22 (32%)
LRR 4 130..151 7/20 (35%)
leucine-rich repeat 131..154 CDD:275380 8/23 (35%)
LRR 5 154..175 8/20 (40%)
leucine-rich repeat 155..178 CDD:275380 10/22 (45%)
LRR 6 178..199 2/20 (10%)
leucine-rich repeat 179..202 CDD:275380 3/22 (14%)
LRR 7 202..223 9/20 (45%)
leucine-rich repeat 203..250 CDD:275380 14/48 (29%)
LRR 8 226..247 3/20 (15%)
LRR 9 250..271 6/20 (30%)
leucine-rich repeat 251..274 CDD:275380 6/22 (27%)
LRR 10 274..295 7/20 (35%)
leucine-rich repeat 275..298 CDD:275380 7/23 (30%)
LRR 11 298..319 3/20 (15%)
leucine-rich repeat 299..322 CDD:275380 4/22 (18%)
LRR 12 322..343 5/20 (25%)
leucine-rich repeat 323..343 CDD:275380 5/19 (26%)
LRRCT 355..408 CDD:214507 10/52 (19%)
Ig 411..500 CDD:472250 8/38 (21%)
Ig strand B 428..432 CDD:409353 0/3 (0%)
Ig strand C 441..445 CDD:409353 112/485 (23%)
Ig strand E 466..470 CDD:409353
Ig strand F 480..485 CDD:409353
Ig strand G 493..496 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.