DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and SLITRK4

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001171678.1 Gene:SLITRK4 / 139065 HGNCID:23502 Length:837 Species:Homo sapiens


Alignment Length:697 Identity:149/697 - (21%)
Similarity:225/697 - (32%) Gaps:268/697 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSEIAPCICTVKKNGLDILCETTDLAHITKSMGTL 76
            |.:.:.|:|..|: ...........::|      ..|.|...:|.|.:.||...:....:    |
Human     1 MFLWLFLILSALI-SSTNADSDISVEIC------NVCSCVSVENVLYVNCEKVSVYRPNQ----L 54

  Fly    77 KGKSPIIFYLKLRHNNLPKLQGFVFLALDIRH-LTIH--NSSLAAIEENALSSLGAGLTQLDVSL 138
            |......::|..::|.|..|....|  |:..| :::|  |:.|..||..|...|.| |.||.::.
Human    55 KPPWSNFYHLNFQNNFLNILYPNTF--LNFSHAVSLHLGNNKLQNIEGGAFLGLSA-LKQLHLNN 116

  Fly   139 NQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFR----- 198
            |::|.:.:.....:.:|..|..::|.|..|...||..|..|::|.|.:|.|:.:....||     
Human   117 NELKILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASLT 181

  Fly   199 ---------------GLEDHIKR---LNLGGND-------------LTNIPQ------------- 219
                           |:.:||.|   |.|..|.             |.|:|.             
Human   182 HLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEAICETPS 246

  Fly   220 ----------------------------------------------------------------- 219
                                                                             
Human   247 DLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLVTKPPKTTNPSK 311

  Fly   220 -------KALS------ILS--------------------------------------------- 226
                   ||||      |:|                                             
Human   312 ISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVNCQEKNIQSMSELIPKP 376

  Fly   227 -TLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVID 290
             ..|||.:..|.|:.:...||...:.||.|.|..|.||.:..:||.:||.|..|.|.||:|..:.
Human   377 LNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDVFHNLTNLRRLYLNGNQIERLY 441

  Fly   291 KDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNL 355
            .:.|.|| .|||||.|..|.|..|.:.....:..|:.|.| |||:                    
Human   442 PEIFSGL-HNLQYLYLEYNLIKEISAGTFDSMPNLQLLYL-NNNL-------------------- 484

  Fly   356 QKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELT---- 416
                :|.||..:|... .|..|||:|||...:|...:...:.:|..||:..||.:|:|:|.    
Human   485 ----LKSLPVYIFSGA-PLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLVALKL 544

  Fly   417 WFPKLLEDLKNKD------------DEMSQKKKPLCHMSLDNREYFVQAMPTEKMHCAGLNVSPS 469
            |..||.:.:..|:            :..|.|.:.||...|:.        |:...      .||:
Human   545 WVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNK--------PSAPF------TSPA 595

  Fly   470 PT-------------SGG-------LMRILQVNILAQ-IAVCSVAFL 495
            |.             .||       ::.||.|.||.. :|.|.:.|:
Human   596 PAITFTTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFV 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 5/19 (26%)
LRR_RI 93..384 CDD:238064 101/466 (22%)
leucine-rich repeat 107..129 CDD:275380 8/24 (33%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
LRR_8 154..214 CDD:290566 22/95 (23%)
leucine-rich repeat 155..178 CDD:275380 8/22 (36%)
leucine-rich repeat 179..203 CDD:275380 8/43 (19%)
leucine-rich repeat 204..227 CDD:275380 14/175 (8%)
LRR_8 226..286 CDD:290566 24/105 (23%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 10/22 (45%)
LRR_8 276..335 CDD:290566 23/58 (40%)
leucine-rich repeat 276..300 CDD:275380 9/23 (39%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 6/23 (26%)
LRR_8 349..409 CDD:290566 16/59 (27%)
leucine-rich repeat 350..373 CDD:275380 4/22 (18%)
SLITRK4NP_001171678.1 LRR 1 60..81 5/22 (23%)
leucine-rich repeat 63..84 CDD:275380 6/22 (27%)
LRR_8 83..143 CDD:316378 17/60 (28%)
LRR 2 84..105 7/20 (35%)
leucine-rich repeat 85..108 CDD:275380 7/22 (32%)
LRR 3 108..129 6/21 (29%)
leucine-rich repeat 109..132 CDD:275380 5/22 (23%)
LRR_8 132..190 CDD:316378 15/57 (26%)
LRR 4 132..153 7/20 (35%)
leucine-rich repeat 133..156 CDD:275380 8/22 (36%)
LRR 5 156..177 6/20 (30%)
leucine-rich repeat 157..179 CDD:275380 7/21 (33%)
LRR 6 179..200 1/20 (5%)
leucine-rich repeat 180..204 CDD:275380 3/23 (13%)
leucine-rich repeat 205..295 CDD:275380 6/89 (7%)
LRRCT 213..>253 CDD:214507 4/39 (10%)
leucine-rich repeat 296..371 CDD:275380 6/74 (8%)
leucine-rich repeat 372..402 CDD:275380 7/29 (24%)
LRR 7 378..399 7/20 (35%)
LRR_8 402..461 CDD:316378 27/59 (46%)
LRR 8 402..423 9/20 (45%)
leucine-rich repeat 403..426 CDD:275380 10/22 (45%)
LRR 9 426..447 7/20 (35%)
leucine-rich repeat 427..450 CDD:275380 9/23 (39%)
LRR 10 450..471 9/20 (45%)
leucine-rich repeat 451..472 CDD:275380 8/20 (40%)
LRR 11 474..495 10/45 (22%)
leucine-rich repeat 475..496 CDD:275380 10/45 (22%)
LRR 12 497..518 8/20 (40%)
leucine-rich repeat 498..522 CDD:275380 8/23 (35%)
PCC 502..>563 CDD:188093 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.