DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrfn4

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_004913580.1 Gene:lrfn4 / 101734445 XenbaseID:XB-GENE-6465078 Length:722 Species:Xenopus tropicalis


Alignment Length:244 Identity:72/244 - (29%)
Similarity:120/244 - (49%) Gaps:25/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            :|.:.:|.||.:.:.||..:..|..|.|:.|.|..:....|..|..|.||.|:||::::|.::|.
 Frog    56 ELRLADNFIRVVEQEDFLNMTGLVDLTLSRNTIDNIKPYAFGDLESLRSLHLDGNRLTLIHEEAL 120

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRPLH-RLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKN 358
            :|: .|||:|.:.:||:.|||.......| .|..|||..||:..:..:|.... .||..|||..|
 Frog   121 RGM-LNLQHLIINNNQLVTIPVATFDDFHLTLEDLDLSYNNLVSVPWEAIQNM-VSLHTLNLDHN 183

  Fly   359 DIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIM-----------EPVIDTLRIIDITDNPLNCS 412
            .|:.:....|..|..|..|::.:|:|..:|.|.:           .|...|: :::...||.:|:
 Frog   184 LIESVMEGTFSELYKLSRLDMTSNRLHTLPPDPLFVRSQTGVISPTPYTSTI-VLNFGGNPFHCN 247

  Fly   413 CELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHC 461
            |||.|..:|:     ::|:|.....|   ..|..|.::  ::|.|:..|
 Frog   248 CELLWLRRLV-----REDDMETCASP---SQLAGRYFW--SIPEEEFTC 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
leucine-rich repeat 107..129 CDD:275380
LRR <131..410 CDD:443914 58/191 (30%)
leucine-rich repeat 131..154 CDD:275380
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380
leucine-rich repeat 228..251 CDD:275380 6/20 (30%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
leucine-rich repeat 276..300 CDD:275380 9/23 (39%)
leucine-rich repeat 301..324 CDD:275380 9/23 (39%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 8/22 (36%)
lrfn4XP_004913580.1 leucine-rich repeat 54..77 CDD:275380 6/20 (30%)
LRR <56..>213 CDD:443914 52/158 (33%)
leucine-rich repeat 78..101 CDD:275380 7/22 (32%)
leucine-rich repeat 102..125 CDD:275380 9/23 (39%)
leucine-rich repeat 126..148 CDD:275380 8/21 (38%)
leucine-rich repeat 151..174 CDD:275380 7/23 (30%)
leucine-rich repeat 175..198 CDD:275380 8/22 (36%)
leucine-rich repeat 199..217 CDD:275380 6/17 (35%)
LRRCT 242..286 CDD:214507 15/53 (28%)
IgI_SALM5_like 289..376 CDD:409421
Ig strand A 289..292 CDD:409421
Ig strand A' 296..299 CDD:409421
Ig strand B 305..313 CDD:409421
Ig strand C 319..324 CDD:409421
Ig strand C' 327..329 CDD:409421
Ig strand D 335..339 CDD:409421
Ig strand E 342..346 CDD:409421
Ig strand F 356..363 CDD:409421
Ig strand G 366..376 CDD:409421
fn3 416..491 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.