DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrrn3b

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_009298331.1 Gene:lrrn3b / 100535105 ZFINID:ZDB-GENE-170217-3 Length:706 Species:Danio rerio


Alignment Length:487 Identity:119/487 - (24%)
Similarity:195/487 - (40%) Gaps:131/487 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 CPEQSEIAPCICTVK----KNGLDILCETTDLAHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGF 99
            ||:.     |:|.::    .:.:.:...|.|    ...:|        :|.|..|          
Zfish    29 CPKL-----CVCEIRPWFSPSSVYMEAPTID----CNDLG--------LFKLPTR---------- 66

  Fly   100 VFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDVSLNQMKTVPSQALQHLFHLLILNLNHNK 164
              |.||.:.|.:..:::|. .|:.|..| ..:|::|:|.|.:.::....:..|..||.|::..|.
Zfish    67 --LPLDTQVLLLQTNNIAK-NEHPLDYL-TNITEIDLSQNNLSSINDINIGSLPQLLSLHMEENW 127

  Fly   165 ITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLK 229
            |..:.:|:...|..|:.|.|..|.|:.|.|||||||:. :.||:|..|.|..|..:....|..|:
Zfish   128 ICSLPDNSLSQLTNLQELYLNHNLISLISPEAFRGLQS-LLRLHLNSNRLQIIKSEWFEPLPNLE 191

  Fly   230 KLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAF 294
            .|.|.||.:.:|.:.:|:.|::|.||:                ||.:|        :|.|..|:|
Zfish   192 ILMIGENPVLSIQDMNFKPLRNLRSLV----------------LTRMN--------LSQIPDDSF 232

  Fly   295 KGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTFLNLQKND 359
            .|| :||:.:...||....:|..|||.|..|:.|||..|.|..:..      ||.:..|:|::..
Zfish   233 LGL-DNLESISFYDNTFPKVPHGALRHLKSLKFLDLNKNPIGRIQR------GDFVDMLHLKELG 290

  Fly   360 IKVLPSLL-------------------------------FENLNSLETLNLQNNKLQRIPQDIME 393
            |..:|.|:                               |..|..||||.|..|.|..:.:..:|
Zfish   291 INSMPELVSIDSFALNNLPELTKIEATNNPKLSYIHPNAFYRLPRLETLMLNGNALSALHRITVE 355

  Fly   394 PVIDTLRIIDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEK 458
            . :..||.:.:..||:.|.|.:.|.                      :|:..|    ::.|..:.
Zfish   356 S-LPNLREVSMHSNPIRCDCVVRWM----------------------NMNKTN----IRFMEPDS 393

  Fly   459 MHCAGLNVSPSPTSGGLMRILQVNILAQIAVC 490
            :.|    |.|....|  ..:.||:....:.:|
Zfish   394 LFC----VEPPEYEG--QHVRQVHFREMMEIC 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 3/19 (16%)
leucine-rich repeat 107..129 CDD:275380 5/21 (24%)
LRR <131..410 CDD:443914 88/309 (28%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
leucine-rich repeat 155..178 CDD:275380 7/22 (32%)
leucine-rich repeat 179..203 CDD:275380 13/23 (57%)
leucine-rich repeat 204..227 CDD:275380 7/22 (32%)
leucine-rich repeat 228..251 CDD:275380 8/22 (36%)
leucine-rich repeat 252..275 CDD:275380 4/22 (18%)
leucine-rich repeat 276..300 CDD:275380 7/23 (30%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 7/23 (30%)
leucine-rich repeat 350..373 CDD:275380 7/53 (13%)
lrrn3bXP_009298331.1 leucine-rich repeat 52..70 CDD:275380 7/41 (17%)
leucine-rich repeat 71..93 CDD:275380 5/23 (22%)
LRR <72..325 CDD:443914 79/286 (28%)
leucine-rich repeat 95..117 CDD:275380 5/21 (24%)
leucine-rich repeat 118..141 CDD:275380 7/22 (32%)
leucine-rich repeat 142..165 CDD:275380 13/22 (59%)
leucine-rich repeat 166..189 CDD:275380 7/22 (32%)
leucine-rich repeat 190..213 CDD:275380 8/22 (36%)
leucine-rich repeat 214..237 CDD:275380 12/47 (26%)
leucine-rich repeat 238..261 CDD:275380 8/22 (36%)
leucine-rich repeat 262..285 CDD:275380 8/28 (29%)
leucine-rich repeat 286..310 CDD:275380 4/23 (17%)
LRR_8 309..370 CDD:404697 13/61 (21%)
leucine-rich repeat 311..333 CDD:275380 1/21 (5%)
leucine-rich repeat 336..357 CDD:275380 8/21 (38%)
leucine-rich repeat 360..372 CDD:275378 4/11 (36%)
LRRCT 368..411 CDD:214507 13/74 (18%)
Ig 421..513 CDD:472250
Ig strand B 440..444 CDD:409353
Ig strand C 453..457 CDD:409353
Ig strand E 479..483 CDD:409353
Ig strand F 493..498 CDD:409353
Ig strand G 506..509 CDD:409353
fn3 518..593 CDD:394996
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.