DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrrc4

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_002939414.1 Gene:lrrc4 / 100493671 XenbaseID:XB-GENE-968937 Length:641 Species:Xenopus tropicalis


Alignment Length:339 Identity:99/339 - (29%)
Similarity:145/339 - (42%) Gaps:64/339 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 LNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKAL 222
            |||..|.|.:|..:.|..|..||:|.|..|.|.||:..||.|                       
 Frog    74 LNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNG----------------------- 115

  Fly   223 SILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFSHLTLLNSLEL-EGNKI 286
              |::|..||:.:|.:..|..|.||.|..|..|.|.:|.|.::|:..|:.:..|..|:| |..|:
 Frog   116 --LASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKL 178

  Fly   287 SVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLT 351
            ..|.:.||:|| .||:||.||...|..:|:  |.||..|..|::..||...:...:|.|. .||.
 Frog   179 EYISEGAFEGL-YNLKYLNLGMCNIRDMPN--LTPLVGLEELEISGNNFPEIKPGSFHGL-RSLK 239

  Fly   352 FLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELT 416
            .|.:..:.|..:....|::|.||..|||.:|.:..:|.|:..| :..|..:.:..||.:|.|::.
 Frog   240 KLWIMNSQINTIERNAFDDLTSLVELNLAHNNVTSLPHDLFAP-LKYLVELHLHHNPWDCDCDVL 303

  Fly   417 WFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMHCAGLNVSPSPTSGGLMRILQV 481
            |....|                        |||    :||... |.|...||....|..:    |
 Frog   304 WLSWWL------------------------REY----IPTNST-CCGRCHSPPHMRGKYV----V 335

  Fly   482 NILAQIAVCSVAFL 495
            .:...:..||..|:
 Frog   336 EVDHSMFQCSAPFI 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 75/226 (33%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566 19/55 (35%)
leucine-rich repeat 155..178 CDD:275380 8/19 (42%)
leucine-rich repeat 179..203 CDD:275380 11/23 (48%)
leucine-rich repeat 204..227 CDD:275380 1/22 (5%)
LRR_8 226..286 CDD:290566 20/60 (33%)
leucine-rich repeat 228..251 CDD:275380 9/22 (41%)
leucine-rich repeat 252..275 CDD:275380 7/22 (32%)
LRR_8 276..335 CDD:290566 24/59 (41%)
leucine-rich repeat 276..300 CDD:275380 10/24 (42%)
leucine-rich repeat 301..324 CDD:275380 10/22 (45%)
leucine-rich repeat 325..349 CDD:275380 6/23 (26%)
LRR_8 349..409 CDD:290566 17/59 (29%)
leucine-rich repeat 350..373 CDD:275380 5/22 (23%)
lrrc4XP_002939414.1 LRRNT 40..71 CDD:214470
LRR <68..285 CDD:227223 78/240 (33%)
leucine-rich repeat 71..94 CDD:275380 8/19 (42%)
leucine-rich repeat 95..118 CDD:275380 12/47 (26%)
leucine-rich repeat 119..142 CDD:275380 9/22 (41%)
leucine-rich repeat 143..166 CDD:275380 7/22 (32%)
leucine-rich repeat 167..191 CDD:275380 10/24 (42%)
leucine-rich repeat 192..213 CDD:275380 10/22 (45%)
leucine-rich repeat 214..237 CDD:275380 6/23 (26%)
leucine-rich repeat 238..261 CDD:275380 5/22 (23%)
leucine-rich repeat 262..283 CDD:275380 8/21 (38%)
LRRCT 294..345 CDD:214507 17/83 (20%)
IG_like 353..435 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.