DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrfn2

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:XP_031758515.1 Gene:lrfn2 / 100491687 XenbaseID:XB-GENE-6035533 Length:765 Species:Xenopus tropicalis


Alignment Length:245 Identity:70/245 - (28%)
Similarity:114/245 - (46%) Gaps:46/245 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 LNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVPANVFS 271
            |.||||.:.:|.::..:.::.|..|.:..|.|..|....|..|:||.||.|..|.:|.:..:||.
 Frog    56 LRLGGNFIISINRQDFANMTGLVDLTLSRNTISYIQPYSFIDLESLRSLHLDSNRLTNLGDDVFR 120

  Fly   272 HLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNIN 336
            .|..|..|.:..|:::.|.:|||:.|.:.|:.|.|..|.:.|:|.:|:|.:..|..|.|.:|.|.
 Frog   121 GLINLQHLIMNNNQLNSIAEDAFEDLLQTLEDLDLSYNNLKTVPWDAVRRMVNLHQLSLDHNLIY 185

  Fly   337 VLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRI 401
            .:.|..                         |::||.|..|:|.:|:||::|.|   |:....:|
 Frog   186 YITEGT-------------------------FQDLNKLARLDLTSNRLQKLPPD---PIFARSQI 222

  Fly   402 -------------IDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKP 438
                         :....|||:|:|||.|..:|     :::|:|.....|
 Frog   223 SMTSATPFSPPLSLSFGGNPLHCNCELLWLRRL-----DREDDMETCASP 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
LRR_RI 93..384 CDD:238064 52/176 (30%)
leucine-rich repeat 107..129 CDD:275380
leucine-rich repeat 131..154 CDD:275380
LRR_8 154..214 CDD:290566 5/6 (83%)
leucine-rich repeat 155..178 CDD:275380
leucine-rich repeat 179..203 CDD:275380
leucine-rich repeat 204..227 CDD:275380 6/19 (32%)
LRR_8 226..286 CDD:290566 20/59 (34%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 9/22 (41%)
LRR_8 276..335 CDD:290566 20/58 (34%)
leucine-rich repeat 276..300 CDD:275380 8/23 (35%)
leucine-rich repeat 301..324 CDD:275380 8/22 (36%)
leucine-rich repeat 325..349 CDD:275380 6/23 (26%)
LRR_8 349..409 CDD:290566 14/72 (19%)
leucine-rich repeat 350..373 CDD:275380 2/22 (9%)
lrfn2XP_031758515.1 LRR_8 51..111 CDD:404697 19/54 (35%)
leucine-rich repeat 53..76 CDD:275380 6/19 (32%)
leucine-rich repeat 77..100 CDD:275380 7/22 (32%)
LRR_8 100..160 CDD:404697 22/59 (37%)
leucine-rich repeat 101..124 CDD:275380 9/22 (41%)
leucine-rich repeat 125..148 CDD:275380 8/22 (36%)
LRR_8 148..208 CDD:404697 21/84 (25%)
leucine-rich repeat 150..173 CDD:275380 8/22 (36%)
leucine-rich repeat 174..197 CDD:275380 8/47 (17%)
LRRCT 241..285 CDD:214507 12/32 (38%)
Ig 288..375 CDD:416386
Ig strand A 288..291 CDD:409353
Ig strand A' 295..298 CDD:409353
Ig strand B 304..312 CDD:409353
Ig strand C 318..323 CDD:409353
Ig strand C' 326..328 CDD:409353
Ig strand D 334..338 CDD:409353
Ig strand E 341..345 CDD:409353
Ig strand F 355..362 CDD:409353
Ig strand G 365..375 CDD:409353
fn3 417..485 CDD:394996
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.