DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lrrn1-like

DIOPT Version :9

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001106456.1 Gene:lrrn1-like / 100127637 XenbaseID:XB-GENE-492890 Length:738 Species:Xenopus tropicalis


Alignment Length:475 Identity:126/475 - (26%)
Similarity:201/475 - (42%) Gaps:91/475 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LQVLVMDQV----LGQGPPQTQVCPEQSEIAPCIC---------TVKKNGLDILCETTDLAHITK 71
            |.|:|:..|    ||       |||.|     |:|         :|......:.|....|.||.:
 Frog    22 LFVIVLHSVFFSTLG-------VCPPQ-----CVCETRPWFTPQSVYHEAKTVDCNDLLLTHIPE 74

  Fly    72 SMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGLTQLDV 136
            ::.|      .|..|.|:.|.:..|...:....::..|.:..:...:|::..:|:|...:| |.:
 Frog    75 NLST------DIQVLLLQSNKISHLTWELQELSNLTELDLSQNHFQSIDDLGVSNLSQLIT-LYL 132

  Fly   137 SLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTLYENKITQIDPEAFRGLE 201
            ..||::.:|..:|:.|..|..|.:|||:|:.|...||.||..|..|.|..|::..|||..|..| 
 Frog   133 EENQLRELPDYSLKDLGSLEELYINHNQISYIGPRAFSGLGRLLRLHLNANRLEIIDPRWFEDL- 196

  Fly   202 DHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGLQSLDSLILAHNMITTVP 266
            .:::.|.:|.|.:|.:.......|..|..|.:...::..|.|..|:||..|:||....|.:|.||
 Frog   197 PNLEILMVGENPVTALQSLNFQPLGRLHSLVLAGMELEHIPENAFQGLDYLESLSFFDNRLTEVP 261

  Fly   267 ANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGD-NQIHTIPSEALRPLHRLRHLDL 330
            .....:|.||..|:|..|.|..|....|.|: |:|:.|.|.. .::..:.:||.:.|..|..|::
 Frog   262 KEALKNLKLLKFLDLNKNPIPEIRGGDFTGM-EHLEELSLNSMEELERVEAEAFQDLPELIKLEM 325

  Fly   331 RNNNINVLAEDAFTGFGDSLTFLNLQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPV 395
            .||              ..|::|:         |.....||.:|:||.|.||:|..:|..|.:.:
 Frog   326 CNN--------------PRLSYLD---------PEAFSSNLGALKTLLLNNNRLAMVPLKIFQAL 367

  Fly   396 IDTLRIIDITDNPLNCSCELTWFPKLLEDLKNKDDEMSQKKKPLCHMSLDNREYFVQAMPTEKMH 460
            ...|. |.:..||:.|.|:..|  |.|..|:                       .::|..|    
 Frog   368 PGLLE-ISLYSNPIRCDCQNCW--KGLSKLR-----------------------LIEAQAT---- 402

  Fly   461 CAGLNVSPSPTSGGLMRILQ 480
               |.::|...||.|.:.:|
 Frog   403 ---LCINPPLVSGHLFQEIQ 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 4/19 (21%)
LRR_RI 93..384 CDD:238064 83/291 (29%)
leucine-rich repeat 107..129 CDD:275380 4/21 (19%)
leucine-rich repeat 131..154 CDD:275380 7/22 (32%)
LRR_8 154..214 CDD:290566 23/59 (39%)
leucine-rich repeat 155..178 CDD:275380 11/22 (50%)
leucine-rich repeat 179..203 CDD:275380 9/23 (39%)
leucine-rich repeat 204..227 CDD:275380 5/22 (23%)
LRR_8 226..286 CDD:290566 20/59 (34%)
leucine-rich repeat 228..251 CDD:275380 7/22 (32%)
leucine-rich repeat 252..275 CDD:275380 8/22 (36%)
LRR_8 276..335 CDD:290566 19/59 (32%)
leucine-rich repeat 276..300 CDD:275380 8/23 (35%)
leucine-rich repeat 301..324 CDD:275380 6/23 (26%)
leucine-rich repeat 325..349 CDD:275380 4/23 (17%)
LRR_8 349..409 CDD:290566 17/59 (29%)
leucine-rich repeat 350..373 CDD:275380 5/22 (23%)
lrrn1-likeNP_001106456.1 NEL <52..>262 CDD:330839 60/217 (28%)
leucine-rich repeat 60..79 CDD:275380 5/24 (21%)
leucine-rich repeat 80..102 CDD:275380 5/21 (24%)
LRR_8 101..161 CDD:316378 16/60 (27%)
leucine-rich repeat 103..126 CDD:275380 4/22 (18%)
leucine-rich repeat 127..150 CDD:275380 7/23 (30%)
leucine-rich repeat 151..174 CDD:275380 11/22 (50%)
leucine-rich repeat 175..198 CDD:275380 9/23 (39%)
leucine-rich repeat 199..222 CDD:275380 5/22 (23%)
leucine-rich repeat 223..246 CDD:275380 7/22 (32%)
leucine-rich repeat 247..294 CDD:275380 17/47 (36%)
LRR_8 294..356 CDD:316378 21/84 (25%)
leucine-rich repeat 295..319 CDD:275380 6/23 (26%)
leucine-rich repeat 320..345 CDD:275380 9/47 (19%)
leucine-rich repeat 346..367 CDD:275380 9/20 (45%)
PCC 351..>412 CDD:188093 20/93 (22%)
leucine-rich repeat 370..382 CDD:275378 4/12 (33%)
Ig 448..515 CDD:319273
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X351
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.