DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14762 and lingo4a

DIOPT Version :10

Sequence 1:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster
Sequence 2:NP_001076447.1 Gene:lingo4a / 100005227 ZFINID:ZDB-GENE-060503-275 Length:618 Species:Danio rerio


Alignment Length:323 Identity:94/323 - (29%)
Similarity:148/323 - (45%) Gaps:34/323 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 LSSLGAGL---TQ-LDVSLNQMKTVPSQALQHLFHLLILNLNHNKITVIHNNAFEGLETLEILTL 184
            ||::..|:   || |:::.|.:||:.|:....|..|..|:|:.|.:|||...||.||:.|..|.|
Zfish    62 LSAVPEGVPDA
TQVLNLTYNHLKTLSSRQFFSLRQLRELDLSANMLTVIEVEAFVGLQNLITLRL 126

  Fly   185 YENKITQIDPEAFRGLEDHIKRLNLGGNDLTNIPQKALSILSTLKKLEIQENKIRTISEGDFEGL 249
            ..|::..|...||.|| .:::.|::..|::..:.......:.:|:|||..||.:..||...|.||
Zfish   127 SRNRLKIIPVGAFSGL-PNVQFLDISENEILVLLDDMFGEMPSLQKLEASENDLVFISNRAFSGL 190

  Fly   250 QSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEE--------------- 299
            .:|..|.|....:||||:..||.||.|..|......::.:..::|:.|:.               
Zfish   191 PNLLELRLERCNLTTVPSEAFSRLTGLQHLRFCRLGLTALPNNSFRQLQRLQDLHVSRCPWLHTL 255

  Fly   300 --------NLQYLRLGDNQIHTIPSEALRPLHRLRHLDLRNNNINVLAEDAFTGFGDSLTF--LN 354
                    ||..|.|....:..:|...|..|..||:|||..|.|..:....   .||.|..  |:
Zfish   256 AVNSLIGLNLTSLTLSHCNLSAVPYAPLHHLVYLRYLDLSYNPITTVLSGL---LGDLLRLQELH 317

  Fly   355 LQKNDIKVLPSLLFENLNSLETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTW 417
            |....:..:.|..|.||.....||:.:|:|..:.:.... .:.:|.::.:..|||.|.|.|.|
Zfish   318 LVSTGLLHVESGAFRNLAFFRLLNVSDNRLVTLEESAFH-AVGSLEVLRLDGNPLACDCRLLW 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380
leucine-rich repeat 107..129 CDD:275380 2/4 (50%)
LRR <131..410 CDD:443914 86/307 (28%)
leucine-rich repeat 131..154 CDD:275380 8/26 (31%)
leucine-rich repeat 155..178 CDD:275380 11/22 (50%)
leucine-rich repeat 179..203 CDD:275380 9/23 (39%)
leucine-rich repeat 204..227 CDD:275380 2/22 (9%)
leucine-rich repeat 228..251 CDD:275380 11/22 (50%)
leucine-rich repeat 252..275 CDD:275380 10/22 (45%)
leucine-rich repeat 276..300 CDD:275380 4/46 (9%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..349 CDD:275380 8/23 (35%)
leucine-rich repeat 350..373 CDD:275380 7/24 (29%)
lingo4aNP_001076447.1 LRRNT 41..70 CDD:214470 3/7 (43%)
leucine-rich repeat 52..72 CDD:275380 3/9 (33%)
leucine-rich repeat 73..96 CDD:275380 8/22 (36%)
LRR 75..379 CDD:443914 88/308 (29%)
leucine-rich repeat 97..120 CDD:275380 11/22 (50%)
leucine-rich repeat 121..144 CDD:275380 9/23 (39%)
leucine-rich repeat 145..168 CDD:275380 2/22 (9%)
leucine-rich repeat 169..192 CDD:275380 11/22 (50%)
leucine-rich repeat 193..216 CDD:275380 10/22 (45%)
leucine-rich repeat 217..240 CDD:275380 4/22 (18%)
leucine-rich repeat 241..288 CDD:275380 7/46 (15%)
leucine-rich repeat 289..310 CDD:275380 8/23 (35%)
leucine-rich repeat 313..336 CDD:275380 6/22 (27%)
leucine-rich repeat 337..356 CDD:275380 4/18 (22%)
Ig 424..512 CDD:472250
Ig strand B 442..446 CDD:409353
Ig strand C 455..459 CDD:409353
Ig strand E 478..482 CDD:409353
Ig strand F 492..497 CDD:409353
Ig strand G 505..508 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.