DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odc1 and LOC1280842

DIOPT Version :10

Sequence 1:NP_477052.2 Gene:Odc1 / 35766 FlyBaseID:FBgn0013307 Length:394 Species:Drosophila melanogaster
Sequence 2:XP_320709.5 Gene:LOC1280842 / 1280842 VectorBaseID:AGAMI1_003034 Length:445 Species:Anopheles gambiae


Alignment Length:121 Identity:28/121 - (23%)
Similarity:43/121 - (35%) Gaps:30/121 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 LSSKVVYDFRSERYVGVFGGRYIRCWKRDQHDMNTVKKIKLYRTVHDLFCLESGQTLLLYTDGSC 124
            :|..|::..||...||            |:.    :.||..:|.:..||.:         |.|:.
Mosquito   122 ISKLVIHKNRSLHCVG------------DKF----IFKIPGWRPLCKLFSI---------TSGTV 161

  Fly   125 ESLESALKTRNKSQQDEAGNVAVPFVDPKTHTIRDVKVL-----LLDNGTPLLTYF 175
            |.....||..|.......|.....|.||..:.|...|.|     ::.:.||::..|
Mosquito   162 EECTEELKEGNLLCIAPGGVREALFSDPNVYDILWGKRLGFAKVIIGSKTPVIPMF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Odc1NP_477052.2 PLPDE_III_ODC 30..391 CDD:143482 28/121 (23%)
LOC1280842XP_320709.5 None

Return to query results.
Submit another query.