DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HES7

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_016880721.1 Gene:HES7 / 84667 HGNCID:15977 Length:265 Species:Homo sapiens


Alignment Length:210 Identity:57/210 - (27%)
Similarity:90/210 - (42%) Gaps:45/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 ESSKEQISPSEPGSCQLMSRKKRRG-------VIEKKRRDRINSSLTELKRLVPSAYEKQG--SA 137
            ::|:|.:.....|:.....|.:.|.       ::||:||||||.||.||:.|:......|.  :.
Human    22 QASREPVHTGSGGAMVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNP 86

  Fly   138 KLEKAEILQLTVEHLKSLQSKTLD----------SLSYDPQRVAMDYHIIGFRECAAEVARYLVT 192
            ||||||||:..|.:|:. :|:...          |...|.:.:|..| :.|||||...:|.:   
Human    87 KLEKAEILEFAVGYLRE-RSRVEPPAAAAPGVPRSPVQDAEALASCY-LSGFRECLLRLAAF--- 146

  Fly   193 IEGMDIQDPLRLRLMSHLQYFV-----QQRELSAKSCASPGGWSPAAPS-----------SSGY- 240
              ..|.....|.:|.|.|..::     :.:.:..:..|......||||:           ..|: 
Human   147 --AHDASPAARAQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHP 209

  Fly   241 QPNCAAAPYQSYAAP 255
            .|.||.:|  |..:|
Human   210 SPRCAWSP--SLCSP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 26/64 (41%)
ORANGE 172..218 CDD:128787 12/50 (24%)
HES7XP_016880721.1 HLH 49..108 CDD:238036 25/59 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.