Sequence 1: | NP_523657.1 | Gene: | Hey / 35764 | FlyBaseID: | FBgn0027788 | Length: | 425 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_149030.2 | Gene: | Hes7 / 84653 | MGIID: | 2135679 | Length: | 225 | Species: | Mus musculus |
Alignment Length: | 217 | Identity: | 60/217 - (27%) |
---|---|---|---|
Similarity: | 91/217 - (41%) | Gaps: | 34/217 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 KKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQG--SAKLEKAEILQLTVEHLKSLQSKTLD--- 161
Fly 162 --SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSC 224
Fly 225 ASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVS--- 286
Fly 287 ----------RTSGSAVTESLP 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Hey | NP_523657.1 | HLH | 100..156 | CDD:238036 | 25/55 (45%) |
ORANGE | 172..218 | CDD:128787 | 12/45 (27%) | ||
Hes7 | NP_149030.2 | HLH | 14..73 | CDD:238036 | 26/59 (44%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 124..225 | 19/100 (19%) | |||
WRPW motif | 221..224 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4304 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |