DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Hes7

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_149030.2 Gene:Hes7 / 84653 MGIID:2135679 Length:225 Species:Mus musculus


Alignment Length:217 Identity:60/217 - (27%)
Similarity:91/217 - (41%) Gaps:34/217 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 KKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQG--SAKLEKAEILQLTVEHLKSLQSKTLD--- 161
            |..:.::||:||||||.||.||:.|:......|.  :.||||||||:..|.:|:. :|:...   
Mouse    14 KMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILEFAVGYLRE-RSRVEPPGV 77

  Fly   162 --SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSC 224
              |...|.:.:|..| :.|||||...:|.:     ..|.....|.:|.|.|..: ::.:......
Mouse    78 PRSPGQDAEALASCY-LSGFRECLLRLAAF-----AHDASPAARSQLFSALHGY-RRPKPPRPEA 135

  Fly   225 ASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQLGGRTSVS--- 286
            ..||..:|..|.... .|....|.:|.......|.:     |.|:.|||..:.:.|...:.:   
Mouse   136 VDPGLPAPRPPLDPA-SPILGPALHQRPPVHQGPPS-----PRLAWSPSHCSSRAGDSGAPAPLT 194

  Fly   287 ----------RTSGSAVTESLP 298
                      |..|:....|||
Mouse   195 GLLPPPPPPYRQDGAPKAPSLP 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 25/55 (45%)
ORANGE 172..218 CDD:128787 12/45 (27%)
Hes7NP_149030.2 HLH 14..73 CDD:238036 26/59 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..225 19/100 (19%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.