DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and AT2G40200

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_181549.1 Gene:AT2G40200 / 818611 AraportID:AT2G40200 Length:254 Species:Arabidopsis thaliana


Alignment Length:181 Identity:51/181 - (28%)
Similarity:84/181 - (46%) Gaps:50/181 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SLKRTLSESDCD--DLYSEESSKEQISPSEPGSC-------QLMSRKKRRGVIEKKRRDRINSSL 120
            ||:...|:||.:  :|....||.....|::  .|       :.:||..|  :.||:|||||||.|
plant    22 SLQSESSDSDWNRFNLGFSSSSFGGNFPAD--DCVGGIEKAESLSRSHR--LAEKRRRDRINSHL 82

  Fly   121 TELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQSKT------------LDSLSYDPQRVAMD 173
            |.|::|||:      |.||:||.:|...:|.:|.|:.|.            .|.::..|:.:: |
plant    83 TALRKLVPN------SDKLDKAALLATVIEQVKELKQKAAESPIFQDLPTEADEVTVQPETIS-D 140

  Fly   174 Y----HIIGFR---------ECAAEVARYLVTIEGMDIQDPL-----RLRL 206
            :    :.|.|:         |..:|:.|.|..::...||..:     |:|:
plant   141 FESNTNTIIFKASFCCEDQPEAISEIIRVLTKLQLETIQAEIISVGGRMRI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 26/55 (47%)
ORANGE 172..218 CDD:128787 11/53 (21%)
AT2G40200NP_181549.1 bHLH_AtAIG1_like 57..136 CDD:381461 29/86 (34%)
ACT_UUR-ACR-like 147..221 CDD:153145 10/45 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto3049
orthoMCL 1 0.900 - - OOG6_108077
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.