DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and BHLHE41

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_110389.1 Gene:BHLHE41 / 79365 HGNCID:16617 Length:482 Species:Homo sapiens


Alignment Length:261 Identity:73/261 - (27%)
Similarity:104/261 - (39%) Gaps:66/261 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 KRTLSESDCDDLYSEESSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAY 131
            ||::...|..|.|                      |....:||||||||||..:.:||.|:|...
Human    33 KRSMKRDDTKDTY----------------------KLPHRLIEKKRRDRINECIAQLKDLLPEHL 75

  Fly   132 EKQGSAKLEKAEILQLTVEHLKSLQSKTLD-------------SLSYDPQRVAMDYHIIGFRECA 183
            :......||||.:|:||::|||:|.:.|..             ||. .|.:..:|....||:.||
Human    76 KLTTLGHLEKAVVLELTLKHLKALTALTEQQHQKIIALQNGERSLK-SPIQSDLDAFHSGFQTCA 139

  Fly   184 AEVARYLVTIEGMDIQDPLRLRLMSHL-----------QYFVQQRELSAKSCASPGGWSPAAPSS 237
            .||.:||...|....::|..::|::||           |...||..||.         ...|||:
Human   140 KEVLQYLSRFESWTPREPRCVQLINHLHAVATQFLPTPQLLTQQVPLSK---------GTGAPSA 195

  Fly   238 SGYQPNCAAAPYQSYAA-PANPGAYVSSYPTLSASPSQQAQQLGGRTSVSRTSG-SAVTESLPSH 300
            :|    .||||....|. ...|.||  ..|.:..  :|.:.:|.........|| ....|:.|..
Human   196 AG----SAAAPCLERAGQKLEPLAY--CVPVIQR--TQPSAELAAENDTDTDSGYGGEAEARPDR 252

  Fly   301 D 301
            :
Human   253 E 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 25/55 (45%)
ORANGE 172..218 CDD:128787 17/56 (30%)
BHLHE41NP_110389.1 bHLH-O_DEC2 31..122 CDD:381593 34/111 (31%)
Necessary for interaction with RXRA and repressor activity towards RXRA. /evidence=ECO:0000269|PubMed:19786558 67..71 2/3 (67%)
ORANGE 129..175 CDD:128787 14/45 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 228..298 5/26 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 438..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.