DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and her7

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_021331987.1 Gene:her7 / 58132 ZFINID:ZDB-GENE-000427-6 Length:221 Species:Danio rerio


Alignment Length:211 Identity:52/211 - (24%)
Similarity:87/211 - (41%) Gaps:52/211 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IGSLKRTLSESDCDDLYSEESSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLV 127
            |..|||        ||.::      |||       |...|..:..:|::||:|:|.||..||.|:
Zfish    12 INQLKR--------DLLTD------ISP-------LRFLKLLKPQVERRRRERMNRSLENLKLLL 55

  Fly   128 PSA--YEKQGSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVAMDYHIIGFRECAAEVARYL 190
            ...  :.:....:|||||||:.||..|:.     .:..|.:.:.......:.||..|..:.||:|
Zfish    56 LQGPEHNQPNQRRLEKAEILEYTVLFLQK-----ANKASKEEEGEEKSQFMEGFSSCLQKAARFL 115

  Fly   191 VTIEGMD----------IQDP-LRLRLMSHLQYFVQQRELSA---------KSCASPGGWSPAAP 235
            :...|::          :..| :||.:..|.:  .|..|.:.         |:..|..|...|..
Zfish   116 LEEGGLEGSVTSMLCQRLAHPTIRLPVRGHSR--KQHAESNPQHHARRPHHKNTVSKAGHPSACR 178

  Fly   236 SSSGYQPNCAAAPYQS 251
            ::.  :|..:.|.::|
Zfish   179 NTK--EPQASRAAFRS 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 21/57 (37%)
ORANGE 172..218 CDD:128787 12/56 (21%)
her7XP_021331987.1 Hairy_orange 100..135 CDD:311465 7/34 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.