DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HES6

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_061115.2 Gene:HES6 / 55502 HGNCID:18254 Length:224 Species:Homo sapiens


Alignment Length:208 Identity:63/208 - (30%)
Similarity:96/208 - (46%) Gaps:28/208 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSL---QSKTLDS 162
            ||.|:.::|||||.|||.||.||:.|:..|   :..||||.||:|:|||..::.:   :::..:.
Human    26 RKARKPLVEKKRRARINESLQELRLLLAGA---EVQAKLENAEVLELTVRRVQGVLRGRAREREQ 87

  Fly   163 LSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRE------LSA 221
            |    |..|.:....|:.:|..||..::.|.:.:|.  .:...|::||...:..||      |..
Human    88 L----QAEASERFAAGYIQCMHEVHTFVSTCQAIDA--TVAAELLNHLLESMPLREGSSFQDLLG 146

  Fly   222 KSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQAQQ--LGGRTS 284
            .:.|.|    |.||..||:.  ...||.....:|..||..:.|  .|..:|..:..|  ..|...
Human   147 DALAGP----PRAPGRSGWP--AGGAPGSPIPSPPGPGDDLCS--DLEEAPEAELSQAPAEGPDL 203

  Fly   285 VSRTSGSAVTESL 297
            |....||..|..:
Human   204 VPAALGSLTTAQI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 27/57 (47%)
ORANGE 172..218 CDD:128787 9/45 (20%)
HES6NP_061115.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31 3/4 (75%)
HLH 23..75 CDD:238036 27/51 (53%)
Hairy_orange 96..134 CDD:311465 9/39 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..205 17/65 (26%)
WRPW motif 221..224
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.