DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HES2

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_061962.2 Gene:HES2 / 54626 HGNCID:16005 Length:173 Species:Homo sapiens


Alignment Length:171 Identity:56/171 - (32%)
Similarity:91/171 - (53%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEHLKSLQSKTLDSL 163
            ||..:.::||:||.|||.||::||.|:.....::.|  :|||||::|::||..|:.|.:.:..:.
Human    14 RKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVLEMTVRFLQELPASSWPTA 78

  Fly   164 SYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDP-LRLRLMSHLQYFVQQRELSA-----K 222
            :..|    .|.:..|:..|.|.:||.|....   :.:| :..||:.||    .:|..||     :
Human    79 APLP----CDSYREGYSACVARLARVLPACR---VLEPAVSARLLEHL----WRRAASATLDGGR 132

  Fly   223 SCASPGGWSPA-APSSSGYQPNCAAAPYQS-YAAPANPGAY 261
            :..|.|..:|| ||:|:   |..|:||..| .:.|..||.:
Human   133 AGDSSGPSAPAPAPASA---PEPASAPVPSPPSPPCGPGLW 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 24/56 (43%)
ORANGE 172..218 CDD:128787 12/46 (26%)
HES2NP_061962.2 HLH 12..70 CDD:238036 24/55 (44%)
ORANGE 84..127 CDD:128787 14/49 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..173 15/46 (33%)
WRPW motif 170..173 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.