DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and Helt

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_008769494.1 Gene:Helt / 498633 RGDID:1564073 Length:241 Species:Rattus norvegicus


Alignment Length:205 Identity:69/205 - (33%)
Similarity:98/205 - (47%) Gaps:29/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 SCQLMSRKK---RRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQ 156
            |.:|..||:   ...||||:||||||..|.||.:.||.|..||.|.||||||||::||::|::|.
  Rat     2 SDRLKERKRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALH 66

  Fly   157 SKTLDSLSYDPQRVA--MDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQREL 219
            |..........:.:|  .:|...|:.||...:..||.|:|.|:.:|....|:::.||   .:..|
  Rat    67 SADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQ---SKARL 128

  Fly   220 SAKSCASPGG---------WSPAAPSSSGYQPNCAAAPYQSYAAPAN----PGA-------YVSS 264
            .|:....|..         ..||.|...|:.|. .|..:...|.|.:    |||       |:||
  Rat   129 GAEPAFPPLSLPEPDFSYQLHPAGPEFPGHSPG-EATVFPQGATPGSFPWPPGAARSPALPYLSS 192

  Fly   265 YPTLSASPSQ 274
            ......:|:|
  Rat   193 ATVPLPTPAQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 32/58 (55%)
ORANGE 172..218 CDD:128787 13/45 (29%)
HeltXP_008769494.1 bHLH-O_HELT 14..69 CDD:381414 32/54 (59%)
Hairy_orange 87..127 CDD:400076 12/42 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.