DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and hes1

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001011194.1 Gene:hes1 / 496617 XenbaseID:XB-GENE-487995 Length:267 Species:Xenopus tropicalis


Alignment Length:362 Identity:97/362 - (26%)
Similarity:143/362 - (39%) Gaps:117/362 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 DLYSEESSKE--------QISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEK 133
            ||..:.||..        ..:|.:|.:.. ..||..:.::||:||.|||.||.:||.|:..|.:|
 Frog     4 DLMEKNSSSPVAATPASMSNTPDKPKTAS-EHRKSSKPIMEKRRRARINESLGQLKTLILDALKK 67

  Fly   134 QGS--AKLEKAEILQLTVEHLKSLQSKTLD-SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEG 195
            ..|  :|||||:||::||:||::||...:. :||.||.  .:..:..||.||..||.|:|.|.||
 Frog    68 DSSRHSKLEKADILEMTVKHLRNLQRVQMTAALSTDPS--VLGKYRAGFSECMNEVTRFLSTCEG 130

  Fly   196 MDIQDPLRLRLMSHLQYFVQQRELSAKSCASPGGWSPAAPSSSGYQPNCAAAPYQSYAAP--ANP 258
              :...:|.||:.||...:.|  ::|.:       .|..|     |...||||:.:|..|  ...
 Frog   131 --VNTDVRTRLLGHLANCMNQ--INAMN-------YPTQP-----QIPAAAAPHPAYGQPLVQLQ 179

  Fly   259 GAYVSSYPT-----LSASPSQQAQQLGGRTSVSRTSGSAVTESLPSHDLHSDSSSQQQQQQQQQQ 318
            ||...|.|.     :...|.:.|:..||                                     
 Frog   180 GAAPQSSPAPIACKMGGPPVEAAKVYGG------------------------------------- 207

  Fly   319 QQQQQHQQQQHQQQQQRTQTTPQPTQQQHYTHDHSAV-HSEQQVPTYIELTNSNRPAAIGSDSLS 382
                             .|..|.|..|..:...:.|. |:...:|.|   ||||    :|: :|.
 Frog   208 -----------------FQLVPAPDGQFAFLITNPAFPHNGSVIPVY---TNSN----VGT-ALP 247

  Fly   383 YSAAPQYPVSGLPGQDYNNSSVLQYATPNGAKPYRPW 419
            .|.:|               ||:...|.:..  :|||
 Frog   248 PSVSP---------------SVMPSVTADSV--WRPW 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 28/57 (49%)
ORANGE 172..218 CDD:128787 17/45 (38%)
hes1NP_001011194.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 9/41 (22%)
bHLH-O_HES1_4 33..95 CDD:381465 30/61 (49%)
Hairy_orange 110..148 CDD:369405 16/39 (41%)
WRPW motif. /evidence=ECO:0000255 264..267 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.