DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and E(spl)mdelta-HLH

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_524503.2 Gene:E(spl)mdelta-HLH / 43150 FlyBaseID:FBgn0002734 Length:173 Species:Drosophila melanogaster


Alignment Length:124 Identity:44/124 - (35%)
Similarity:71/124 - (57%) Gaps:5/124 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS--AKLEKAEILQLTVEHLKS-LQSKTLDS 162
            ||..:.::|:|||.|:|..|.|||.|:....:.||.  :|||||:||:|||.:||: .|.:..:.
  Fly    16 RKVTKPLLERKRRARMNLYLDELKDLIVDTMDAQGEQVSKLEKADILELTVNYLKAQQQQRVANP 80

  Fly   163 LSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQ--DPLRLRLMSHLQYFVQQREL 219
            .|..|.:|.:|....|:.:.|.||:....|:.|:|::  ..|..:|...|:...|:.|:
  Fly    81 QSPPPDQVNLDKFRAGYTQAAYEVSHIFSTVPGLDLKFGTHLMKQLGHQLKDMKQEEEI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 27/57 (47%)
ORANGE 172..218 CDD:128787 12/47 (26%)
E(spl)mdelta-HLHNP_524503.2 bHLH-O_ESMB_like 9..77 CDD:381584 28/60 (47%)
ORANGE 91..135 CDD:128787 11/43 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.