DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and helt

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_996948.1 Gene:helt / 404275 ZFINID:ZDB-GENE-040824-6 Length:270 Species:Danio rerio


Alignment Length:269 Identity:75/269 - (27%)
Similarity:110/269 - (40%) Gaps:80/269 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PPPQSHHSAHSNHSHGHSQGHSHGIGSLKRTLSESDCDD---------LYSEESSKEQISPSEPG 94
            |||.|           .||..:.| ....|||.....|:         .|...:||         
Zfish    10 PPPVS-----------SSQSEASG-KRRTRTLDALGFDNYIICNYRLVFYEMMASK--------- 53

  Fly    95 SCQLMSRKK---RRGVIEKKRRDRINSSLTELKRLVPSAYEKQGSAKLEKAEILQLTVEHLKSLQ 156
               :..|||   ...||||:||||||..|.||.:.||.|..||.|.||||||||::||::|::|.
Zfish    54 ---MKDRKKTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQNSGKLEKAEILEMTVQYLRALH 115

  Fly   157 S----------KTLDSLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQ 211
            |          :.|...:        :|...|:.||...:..||.|:|.|:.:|....|:::   
Zfish   116 SADFPRGREKGELLTEFA--------NYFHYGYHECMKNLVHYLTTVERMETKDTKYARILA--- 169

  Fly   212 YFVQQRELSAKSCASPGGWSP-------------AAPSSSGYQP---------NCAAAPYQSYAA 254
             |:|.:.::.....|.|..||             .:|:.|.:|.         :...:|..:|.|
Zfish   170 -FLQSKVVTEPVFGSLGTISPDPTDLLCQLEYQSPSPTESVFQQSPPGHFSWHSSTRSPTLAYPA 233

  Fly   255 PANPGAYVS 263
            .:....|:|
Zfish   234 MSQHSGYLS 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 33/58 (57%)
ORANGE 172..218 CDD:128787 13/45 (29%)
heltNP_996948.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 7/25 (28%)
HLH 62..115 CDD:278439 30/52 (58%)
Hairy_orange 136..173 CDD:284859 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.