DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and HES3

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001019769.1 Gene:HES3 / 390992 HGNCID:26226 Length:186 Species:Homo sapiens


Alignment Length:211 Identity:70/211 - (33%)
Similarity:96/211 - (45%) Gaps:40/211 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IEKKRRDRINSSLTELKRLVPSAYEKQ-GSAKLEKAEILQLTVEHLKSLQSKTLDSLSYDPQRVA 171
            :|||||.|||.||.:||.|:...|..| ...|||||:||:|:|::::|||: :|..|...|:...
Human     1 MEKKRRARINVSLEQLKSLLEKHYSHQIRKRKLEKADILELSVKYMRSLQN-SLQGLWPVPRGAE 64

  Fly   172 MDYHIIGFRECAAEVARYLVTIEGMDIQDPLRLRLMSHLQYFVQQRELSAKSCASPGGWSPAAPS 236
            ..   .|||.|...|::.|  ..|.::...||..|:.         |.:|.|.....|....||:
Human    65 QP---SGFRSCLPGVSQLL--RRGDEVGSGLRCPLVP---------ESAAGSTMDSAGLGQEAPA 115

  Fly   237 SSGYQPNCAA--APYQSYAAPANPGAYV---SSYPTLSAS--PSQQAQQ-------LGGRTSVSR 287
            .  ::|...|  ||..:...|.:|...:   .|.|..|||  |.|.|..       ||.|  |.|
Human   116 L--FRPCTPAVWAPAPAAGGPRSPPPLLLLPESLPGSSASVPPPQPASSRCAESPGLGLR--VWR 176

  Fly   288 TSGSAVTESLPSHDLH 303
            ..||      |..||:
Human   177 PWGS------PGDDLN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 25/48 (52%)
ORANGE 172..218 CDD:128787 10/45 (22%)
HES3NP_001019769.1 HLH 1..54 CDD:238036 27/53 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..186 19/65 (29%)
WRPW motif 175..178 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4304
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.