DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hey and dpn

DIOPT Version :9

Sequence 1:NP_523657.1 Gene:Hey / 35764 FlyBaseID:FBgn0027788 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_476923.1 Gene:dpn / 35800 FlyBaseID:FBgn0010109 Length:435 Species:Drosophila melanogaster


Alignment Length:446 Identity:105/446 - (23%)
Similarity:168/446 - (37%) Gaps:124/446 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DCDDLYSEE--SSKEQISPSEPGSCQLMSRKKRRGVIEKKRRDRINSSLTELKRLVPSAYEKQGS 136
            ||.:.||:.  |:....:|:.....:|  ||..:.::||:||.|||..|.|||.|:..|.:|..:
  Fly    14 DCSNGYSDSYGSNGRMSNPNGLSKAEL--RKTNKPIMEKRRRARINHCLNELKSLILEAMKKDPA 76

  Fly   137 --AKLEKAEILQLTVEHLKSLQSKTLD-SLSYDPQRVAMDYHIIGFRECAAEVARYLVTIEGMDI 198
              .|||||:||::||:||:|:|.:.|: ::..||. |...:. .||.|||.||.||:..::|:| 
  Fly    77 RHTKLEKADILEMTVKHLQSVQRQQLNMAIQSDPS-VVQKFK-TGFVECAEEVNRYVSQMDGID- 138

  Fly   199 QDPLRLRLMSHLQYFVQQRE----LSAKSCASPGGWSPA-------------------------- 233
             ..:|.||.:||.......|    :|..|....||..||                          
  Fly   139 -TGVRQRLSAHLNQCANSLEQIGSMSNFSNGYRGGLFPATAVTAAPTPLFPSLPQDLNNNSRTES 202

  Fly   234 -APS--SSGYQ---------------PNCAAAPYQSYAAPANPGAYVSSYPTLSASPSQQA---- 276
             ||:  ..|.|               ||..:|     |.|..|.|:..|...::|..:..|    
  Fly   203 SAPAIQMGGLQLIPSRLPSGEFALIMPNTGSA-----APPPGPFAWPGSAAGVAAGTASAALASI 262

  Fly   277 ---------QQLGGRTSVSRTSGSAVTESLPSHDLHS-DSSSQQQQQQQQQQQQQQQHQQQQHQQ 331
                     .|....::.|:...::|..:||.:.:|: ...:|...:...............|.:
  Fly   263 ANPTHLNDYTQSFRMSAFSKPVNTSVPANLPENLIHTLPGQTQLPVKNSTSPPLSPISSISSHCE 327

  Fly   332 QQQRTQ---------------TTPQPTQQQHY------------THDHSA-----VH-SEQQVPT 363
            :.:...               :||.||..:..            :||.|.     .| .:|||.:
  Fly   328 ESRAASPTVDVMSKHSFAGVFSTPPPTSAETSFNTSGSLNLSAGSHDSSGCSRPLAHLQQQQVSS 392

  Fly   364 YIELTNSNRPAAIGSDSLSYSAAPQYPVSGLPGQDYNNSSVLQYATPNGAKPYRPW 419
            ...:...:|.|...|...|.             .:.::...|..|....:..:|||
  Fly   393 TSGIAKRDREAEAESSDCSL-------------DEPSSKKFLAGAIEKSSSAWRPW 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HeyNP_523657.1 HLH 100..156 CDD:238036 28/57 (49%)
ORANGE 172..218 CDD:128787 16/45 (36%)
dpnNP_476923.1 HLH 39..101 CDD:238036 30/63 (48%)
ORANGE 114..158 CDD:128787 16/46 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I4621
eggNOG 1 0.900 - - E1_KOG4304
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10985
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.